Overview

  • Product name

  • Description

    Rabbit polyclonal to DDX50
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DDX50 aa 1-210.
    Sequence:

    MPGKLLWGDIMELEAPLEESESQKKERQKSDRRKSRHHYDSDEKSETREN GVTDDLDAPKAKKSKMKEKLNGDTEEGFNRLSDEFSKSHKSRRKDLPNGD IDEYEKKSKRVSSLDTSTHKSSDNKLEETLTREQKEGAFSNFPISEETIK LLKGRGVTYLFPIQVKTFGPVYEGKDLIAQARTGTGKTFSFAIPLIERLQ RNQETIKKSR


    Database link: Q9BQ39

  • Positive control

    • WB: HeLa, Jurkat, K562 and HEK-293T whole cell lysates. IHC-P: Human thyroid tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235368 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 83 kDa.
IHC-P 1/20 - 1/200.

Target

  • Sequence similarities

    Belongs to the DEAD box helicase family. DDX21/DDX50 subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localization

    Nucleus > nucleolus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4933429B04Rik antibody
    • ATP-dependent RNA helicase DDX50 antibody
    • Ddx50 antibody
    • DDX50_HUMAN antibody
    • DEAD (Asp-Glu-Ala-Asp) box polypeptide 50 antibody
    • DEAD box protein 50 antibody
    • Gu beta antibody
    • Gu-beta antibody
    • GU2 antibody
    • GUB antibody
    • MGC109605 antibody
    • MGC3199 antibody
    • Nucleolar protein Gu2 antibody
    • RH II antibody
    • RH II/GuB antibody
    • RNA helicase II / Gu beta antibody
    see all

Images

  • All lanes : Anti-DDX50 antibody (ab235368) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 3 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
    Lane 4 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 83 kDa

  • Paraffin-embedded human thyroid tissue stained for DDX50 using ab235368 at 1/100 dilution in immunohistochemical analysis.

References

ab235368 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235368.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up