Overview

  • Product name

  • Description

    Rabbit polyclonal to DDX6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Chicken, Xenopus laevis, Orangutan, Xenopus tropicalis
  • Immunogen

    Recombinant fragment corresponding to Human DDX6 aa 1-149.
    Sequence:

    MSTARTENPVIMGLSSQNGQLRGPVKPTGGPGGGGTQTQQQMNQLKNTNT INNGTQQQAQSMTTTIKPGDDWKKTLKLPPKDLRIKTSDVTSTKGNEFED YCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGA


    Database link: P26196

  • Positive control

    • WB: HepG2 whole cell lysate (ab7900). IHC-P: Human colon cancer tissue. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234837 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 54 kDa.
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Relevance

    DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis and cellular growth and division. In the process of mRNA degradation, DDX6 may play a role in mRNA decapping. It forms a complex with DCP1A, DCP2, EDC3 and EDC4/HEDLS.
  • Cellular localization

    Cytoplasm; P-body. Note: Processing bodies (PB).
  • Database links

  • Alternative names

    • ATP dependent RNA helicase DDX6 antibody
    • ATP dependent RNA helicase p54 antibody
    • DDX6 antibody
    • DEAD (Asp Glu Ala Asp) box polypeptide 6 antibody
    • DEAD box 6 antibody
    • DEAD box protein 6 antibody
    • DEAD/H (Asp Glu Ala Asp/His) box polypeptide 6 (RNA helicase 54kD) antibody
    • FLJ36338 antibody
    • HLR2 antibody
    • Oncogene RCK antibody
    • P54 antibody
    • Probable ATP-dependent RNA helicase DDX6 antibody
    • RCK antibody
    see all

Images

  • HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for DDX6 (green) using ab234837 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® congugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human colon cancer tissue stained for DDX6 with ab234837 at 1/100 dilution in immunohistochemical analysis.

  • Anti-DDX6 antibody (ab234837) at 1/1000 dilution + HepG2 (Human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 54 kDa

References

ab234837 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234837.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up