Overview

  • Product name
    Anti-Deadpan antibody [11D1CH11]
    See all Deadpan primary antibodies
  • Description
    Rat monoclonal [11D1CH11] to Deadpan
  • Host species
    Rat
  • Tested applications
    Suitable for: IHC, ICC/IFmore details
  • Species reactivity
    Reacts with: Drosophila melanogaster
  • Immunogen

    Recombinant full length protein corresponding to Fruit fly (Drosophila melanogaster) Deadpan aa 1-435.
    Sequence:

    MDYKNDINSDDDFDCSNGYSDSYGSNGRMSNPNGLSKAELRKTNKPIMEK RRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSVQRQ QLNMAIQSDPSVVQKFKTGFVECAEEVNRYVSQMDGIDTGVRQRLSAHLN QCANSLEQIGSMSNFSNGYRGGLFPATAVTAAPTPLFPSLPQDLNNNSRT ESSAPAIQMGGLQLIPSRLPSGEFALIMPNTGSAAPPPGPFAWPGSAAGV AAGTASAALASIANPTHLNDYTQSFRMSAFSKPVNTSVPANLPENLIHTL PGQTQLPVKNSTSPPLSPISSISSHCEESRAASPTVDVMSKHSFAGVFST PPPTSAETSFNTSGSLNLSAGSHDSSGCSRPLAHLQQQQVSSTSGIAKRD REAEAESSDCSLDEPSSKKFLAGAIEKSSSAWRPW


    Database link: Q26263

  • Positive control
    • Drosophila stage 11 embryos
  • General notes

    This antibody clone is manufactured by Abcam.

    Product was previously marketed under the MitoSciences sub-brand.

    If you require this antibody in a particular buffer formulation or a particular conjugate for your experiments, please contact orders@abcam.com or you can find further information here.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C. Do Not Freeze.
  • Storage buffer
    Preservative: 0.02% Sodium azide
    Constituent: 99% HEPES buffered saline
  • Concentration information loading...
  • Purification notes
    >95% based on SDS-PAGE
  • Clonality
    Monoclonal
  • Clone number
    11D1CH11
  • Isotype
    IgG2b
  • Light chain type
    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab195172 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC Use at an assay dependent concentration.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Relevance
    Transcriptional repressor of genes that require a bHLH protein for their transcription. Likely to be involved in the functional rather than the morphological differentiation of neurons. Loss of DPN function results in weak motor activity, lethargic behavior, and death. Implicated in sex determination as Groucho-DPN complex act directly to repress SXL transcription
  • Cellular localization
    Nuclear
  • Database links
    • Alternative names
      • deadpan antibody
      • Dpn antibody
      • Protein deadpan antibody

    Images

    • Immunohistochemistry analysis Drosophila stage 11 embryo labeling Deadpan with ab195172 at 10 µg/mL, followed by Alexa405 conjugated goat anti-rat secondary (at 10µg/mL).

    References

    This product has been referenced in:
    • Yang CP  et al. Imp and Syp RNA-binding proteins govern decommissioning ofDrosophilaneural stem cells. Development 144:3454-3464 (2017). Read more (PubMed: 28851709) »
    • Schoborg T  et al. An Asp-CaM complex is required for centrosome-pole cohesion and centrosome inheritance in neural stem cells. J Cell Biol 211:987-98 (2015). Read more (PubMed: 26620907) »
    See all 2 Publications for this product

    Customer reviews and Q&As

    Application
    Immunocytochemistry/ Immunofluorescence
    Blocking step
    BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 22°C
    Sample
    Fruit fly (Drosophila melanogaster) Cell (Drosophila Wing Imaginal disc)
    Specification
    Drosophila Wing Imaginal disc
    Permeabilization
    Yes - 0.5% Triton X100
    Fixative
    Formaldehyde

    Abcam user community

    Verified customer

    Submitted Feb 12 2015

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up