Overview

  • Product name

    Anti-Decorin antibody [5E8E7]
    See all Decorin primary antibodies
  • Description

    Mouse monoclonal [5E8E7] to Decorin
  • Host species

    Mouse
  • Tested applications

    Suitable for: Flow Cyt, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Sheep, Rabbit, Horse, Cow, Dog, Pig, Chimpanzee
  • Immunogen

    Recombinant fragment corresponding to Human Decorin aa 263-324. (Expressed in E.coli).
    Sequence:

    GSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDF CPPGHNTKKASY


    Database link: P07585

  • Positive control

    • Human Decorin recombinant protein; Decorin (aa: 263-324)-hIgGFc transfected HEK293 cell lysate; HEK293 cells.
  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR150953-11 are from Tissue Culture Supernatant

     

Properties

Applications

Our Abpromise guarantee covers the use of ab181456 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/200 - 1/4000.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

WB 1/500 - 1/2000. Predicted molecular weight: 40 kDa.

Target

  • Function

    May affect the rate of fibrils formation.
  • Involvement in disease

    Defects in DCN are the cause of congenital stromal corneal dystrophy (CSCD) [MIM:610048]. Corneal dystrophies are inherited, bilateral, primary alterations of the cornea that are not associated with prior inflammation or secondary to systemic disease. Most show autosomal dominant inheritance.
  • Sequence similarities

    Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class I subfamily.
    Contains 12 LRR (leucine-rich) repeats.
  • Post-translational
    modifications

    The attached glycosaminoglycan chain can be either chondroitin sulfate or dermatan sulfate depending upon the tissue of origin.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • Bone proteoglycan II antibody
    • CSCD antibody
    • DCN antibody
    • DCN protein antibody
    • Decorin antibody
    • Decorin proteoglycan antibody
    • Dermatan sulphate proteoglycans II antibody
    • DKFZp686J19238 antibody
    • DSPG 2 antibody
    • DSPG2 antibody
    • PG 40 antibody
    • PG II antibody
    • PG S2 antibody
    • PG-S2 antibody
    • PG40 antibody
    • PGII antibody
    • PGS 2 antibody
    • PGS2 antibody
    • PGS2_HUMAN antibody
    • Proteoglycan core protein antibody
    • SLRR1B antibody
    • Small leucine rich protein 1B antibody
    see all

Images

  • Anti-Decorin antibody [5E8E7] (ab181456) at 1/500 dilution + Human Decorin recombinant protein

    Predicted band size: 40 kDa



    Expected MWt is 32.5 kDa.

  • All lanes : Anti-Decorin antibody [5E8E7] (ab181456) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : Decorin (aa: 263-324)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 40 kDa

  • Flow cytometric analysis of HEK293 cells labeling Decorin with ab181456 at 1/200 dilution (green), compared to a negative control (red).

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181456.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up