Anti-Decorin antibody (ab175404)
Key features and details
- Rabbit polyclonal to Decorin
- Suitable for: ICC/IF, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-Decorin antibody
See all Decorin primary antibodies -
Description
Rabbit polyclonal to Decorin -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WBmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant fragment corresponding to Human Decorin aa 31-359.
Sequence:DEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLP PDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVK LERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIE LGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDG NKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNK LTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLF SNPVQYWEIQPSTFRCVYVRSAIQLGNYK
Database link: P07585 -
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol, 49% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab175404 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF |
Use at an assay dependent concentration.
|
|
WB |
1/500 - 1/2000. Predicted molecular weight: 40 kDa.
|
Notes |
---|
ICC/IF
Use at an assay dependent concentration. |
WB
1/500 - 1/2000. Predicted molecular weight: 40 kDa. |
Target
-
Function
May affect the rate of fibrils formation. -
Involvement in disease
Defects in DCN are the cause of congenital stromal corneal dystrophy (CSCD) [MIM:610048]. Corneal dystrophies are inherited, bilateral, primary alterations of the cornea that are not associated with prior inflammation or secondary to systemic disease. Most show autosomal dominant inheritance. -
Sequence similarities
Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class I subfamily.
Contains 12 LRR (leucine-rich) repeats. -
Post-translational
modificationsThe attached glycosaminoglycan chain can be either chondroitin sulfate or dermatan sulfate depending upon the tissue of origin. -
Cellular localization
Secreted > extracellular space > extracellular matrix. - Information by UniProt
-
Database links
- Entrez Gene: 1634 Human
- Entrez Gene: 13179 Mouse
- Omim: 125255 Human
- SwissProt: P07585 Human
- SwissProt: P28654 Mouse
- Unigene: 728830 Human
- Unigene: 56769 Mouse
-
Alternative names
- Bone proteoglycan II antibody
- CSCD antibody
- DCN antibody
see all
Images
-
All lanes : Anti-Decorin antibody (ab175404) at 1/1000 dilution
Lane 1 : Mouse heart lysate
Lane 2 : Mouse liver lysate
Lysates/proteins at 25 µg per lane.
Secondary
All lanes : HRP Goat Anti-Rabbit IgG (H+L) at 1/10000 dilution
Developed using the ECL technique.
Predicted band size: 40 kDaBlocking buffer: 3% nonfat dry milk in TBST.
-
Immunofluorescence analysis of MCF-7 (human breast adenocarcinoma cell line) cells stained for Decorin (green) using ab175404.
DAPI used for nuclear staining (blue).
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (15)
ab175404 has been referenced in 15 publications.
- Best KT et al. Scleraxis-lineage cell depletion improves tendon healing and disrupts adult tendon homeostasis. Elife 10:N/A (2021). PubMed: 33480357
- Zheng X et al. Cancer-Associated Fibroblasts Promote Vascular Invasion of Hepatocellular Carcinoma via Downregulating Decorin-integrin β1 Signaling. Front Cell Dev Biol 9:678670 (2021). PubMed: 34504839
- Qian SJ et al. Single-Cell RNA Sequencing Identifies New Inflammation-Promoting Cell Subsets in Asian Patients With Chronic Periodontitis. Front Immunol 12:711337 (2021). PubMed: 34566966
- Patel KS et al. Decorin expression is associated with predictive diffusion MR phenotypes of anti-VEGF efficacy in glioblastoma. Sci Rep 10:14819 (2020). PubMed: 32908231
- Jiang D et al. Injury triggers fascia fibroblast collective cell migration to drive scar formation through N-cadherin. Nat Commun 11:5653 (2020). PubMed: 33159076