Overview

  • Product name

    Anti-Dectin-1 antibody [9A44]
    See all Dectin-1 primary antibodies
  • Description

    Rat Monoclonal [9A44] to Dectin-1
  • Host species

    Rat
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Mouse Dectin-1 aa 69-243. NP_064392.2.
    Sequence:

    EYGHNSGRNPEEKDNFLSRNKENHKPTESSLDEKVAPSKASQTTGGFSQP CLPNWIMHGKSCYLFSFSGNSWYGSKRHCSQLGAHLLKIDNSKEFEFIES QTSSHRINAFWIGLSRNQSEGPWFWEDGSAFFPNSFQVRNTAPQESLLHN CVWIHGSEVYNQICNTSSYSICEKE


    Database link: Q6QLQ4

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: 100% PBS
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Clonality

    Monoclonal
  • Clone number

    9A44
  • Isotype

    IgG2
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab196522 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 27 kDa.

Target

  • Function

    Lectin that functions as pattern receptor specific for beta-1,3-linked and beta-1,6-linked glucans, such as cell wall constituents from pathogenic bacteria and fungi. Necessary for the TLR2-mediated inflammatory response and for TLR2-mediated activation of NF-kappa-B. Enhances cytokine production in macrophages and dendritic cells. Mediates production of reactive oxygen species in the cell. Mediates phagocytosis of C.albicans conidia. Binds T-cells in a way that does not involve their surface glycans and plays a role in T-cell activation. Stimulates T-cell proliferation.
  • Tissue specificity

    Highly expressed in peripheral blood leukocytes and dendritic cells. Detected in spleen, bone marrow, lung, muscle, stomach and placenta.
  • Involvement in disease

    Defects in CLEC7A may be a cause of familial candidiasis type 4 (CANDF4) [MIM:613108]. It is a rare disorder with altered immune responses and impaired clearance of fungal infections, selective against Candida. It is characterized by persistent and/or recurrent infections of the skin, nails and mucous membranes caused by organisms of the genus Candida, mainly Candida albicans.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Post-translational
    modifications

    Phosphorylated on tyrosine residues in response to glucan binding.
  • Cellular localization

    Cytoplasm and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Beta GR antibody
    • Beta-glucan receptor antibody
    • BGR antibody
    • C type calcium dependent carbohydrate recognition domain lectin superfamily member 12 antibody
    • C type lectin domain family 7 member a antibody
    • C-type lectin domain family 7 member A antibody
    • C-type lectin superfamily member 12 antibody
    • CANDF4 antibody
    • CLC7A_HUMAN antibody
    • CLEC7A antibody
    • CLEC7A protein antibody
    • Clecsf12 antibody
    • DC-associated C-type lectin 1 antibody
    • Dectin 1 antibody
    • DECTIN 1 receptor antibody
    • Dectin-1 antibody
    • Dectin1 antibody
    • Dendritic cell associated C type lectin 1 antibody
    • Dendritic cell-associated C-type lectin 1 antibody
    • Lectin like receptor 1 antibody
    • Putative transmembrane protein dectin 1 antibody
    see all

References

ab196522 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196522.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up