Anti-DEF6 antibody (ab247011)
Key features and details
- Rabbit polyclonal to DEF6
- Suitable for: WB, IHC-P
- Reacts with: Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-DEF6 antibody
See all DEF6 primary antibodies -
Description
Rabbit polyclonal to DEF6 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Rat, Human -
Immunogen
Recombinant fragment corresponding to Human DEF6 aa 521-610.
Sequence:RADEDVEAAQRKLRQASTNVKHWNVQMNRLMHPIEPGDKRPVTSSSFSGF QPPLLAHRDSSLKRLTRWGSQGNRTPSPNSNEQQKSLNGG
Database link: Q9H4E7 -
Positive control
- IHC-P: Human lymph node tissue. WB: NBT-II, RT4 and A431 cell lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab247011 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. | |
IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Phosphatidylinositol 3,4,5-trisphosphate-dependent guanine nucleotide exchange factor (GEF) which plays a role in the activation of Rho GTPases RAC1, RhoA and CDC42. Can regulate cell morphology in cooperation with activated RAC1. Plays a role in Th2 (T helper cells) development and/or activation, perhaps by interfering with ZAP-70 signaling. -
Tissue specificity
Broadly expressed in the immune system and can be detected in T and B-cells. -
Sequence similarities
Contains 1 PH domain. -
Domain
The PH domain is essential for phosphatidylinositol 3,4,5-trisphosphate binding. -
Post-translational
modificationsTyrosine-phosphorylated by tyrosine-protein kinase LCK in response to T-cell activation. -
Cellular localization
Cytoplasm. Cell membrane. Nucleus. Recruited to the plasma membrane upon binding phosphatidylinositol 3,4,5-trisphosphate. - Information by UniProt
-
Database links
- Entrez Gene: 50619 Human
- Entrez Gene: 309642 Rat
- Omim: 610094 Human
- SwissProt: Q9H4E7 Human
- Unigene: 15476 Human
-
Alternative names
- DEF-6 antibody
- Def6 antibody
- DEFI6_HUMAN antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DEF6 antibody (ab247011)Paraffin-embedded human lymph node tissue stained for DEF6 using ab247011 at 1/500 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DEF6 antibody (ab247011)
Paraffin-embedded human kidney tissue stained for DEF6 using ab247011 at 1/500 dilution in immunohistochemical analysis. Low expression as expected.
-
Anti-DEF6 antibody (ab247011) at 0.4 µg/ml + RT4 (Human urinary bladder cancer cell line) cell lysate
-
All lanes : Anti-DEF6 antibody (ab247011) at 0.4 µg/ml
Lane 1 : NIH/3T3 (Mouse embryo fibroblast cell line) cell lysate
Lane 2 : NBT-II (Rat cell line) cell lysate -
All lanes : Anti-DEF6 antibody (ab247011) at 0.4 µg/ml
Lane 1 : A431 (Human epidermoid carcinoma cell line) cell lysate
Lane 2 : A549 (Human lung carcinoma cell line) cell lysate
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab247011 has not yet been referenced specifically in any publications.