Anti-DEF6 antibody (ab247011)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-DEF6 antibody
See all DEF6 primary antibodies -
Description
Rabbit polyclonal to DEF6 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Rat, Human -
Immunogen
Recombinant fragment corresponding to Human DEF6 aa 521-610.
Sequence:RADEDVEAAQRKLRQASTNVKHWNVQMNRLMHPIEPGDKRPVTSSSFSGF QPPLLAHRDSSLKRLTRWGSQGNRTPSPNSNEQQKSLNGG
Database link: Q9H4E7 -
Positive control
- IHC-P: Human lymph node tissue. WB: NBT-II, RT4 and A431 cell lysate.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab247011 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.4 µg/ml. | |
| IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Phosphatidylinositol 3,4,5-trisphosphate-dependent guanine nucleotide exchange factor (GEF) which plays a role in the activation of Rho GTPases RAC1, RhoA and CDC42. Can regulate cell morphology in cooperation with activated RAC1. Plays a role in Th2 (T helper cells) development and/or activation, perhaps by interfering with ZAP-70 signaling. -
Tissue specificity
Broadly expressed in the immune system and can be detected in T and B-cells. -
Sequence similarities
Contains 1 PH domain. -
Domain
The PH domain is essential for phosphatidylinositol 3,4,5-trisphosphate binding. -
Post-translational
modificationsTyrosine-phosphorylated by tyrosine-protein kinase LCK in response to T-cell activation. -
Cellular localization
Cytoplasm. Cell membrane. Nucleus. Recruited to the plasma membrane upon binding phosphatidylinositol 3,4,5-trisphosphate. - Information by UniProt
-
Database links
- Entrez Gene: 50619 Human
- Entrez Gene: 309642 Rat
- Omim: 610094 Human
- SwissProt: Q9H4E7 Human
- Unigene: 15476 Human
-
Alternative names
- DEF-6 antibody
- Def6 antibody
- DEFI6_HUMAN antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DEF6 antibody (ab247011)Paraffin-embedded human lymph node tissue stained for DEF6 using ab247011 at 1/500 dilution in immunohistochemical analysis. -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DEF6 antibody (ab247011)Paraffin-embedded human kidney tissue stained for DEF6 using ab247011 at 1/500 dilution in immunohistochemical analysis. Low expression as expected.
-
Western blot - Anti-DEF6 antibody (ab247011)Anti-DEF6 antibody (ab247011) at 0.4 µg/ml + RT4 (Human urinary bladder cancer cell line) cell lysate -
Western blot - Anti-DEF6 antibody (ab247011)All lanes : Anti-DEF6 antibody (ab247011) at 0.4 µg/ml
Lane 1 : NIH/3T3 (Mouse embryo fibroblast cell line) cell lysate
Lane 2 : NBT-II (Rat cell line) cell lysate -
Western blot - Anti-DEF6 antibody (ab247011)All lanes : Anti-DEF6 antibody (ab247011) at 0.4 µg/ml
Lane 1 : A431 (Human epidermoid carcinoma cell line) cell lysate
Lane 2 : A549 (Human lung carcinoma cell line) cell lysate
Datasheets and documents
References
ab247011 has not yet been referenced specifically in any publications.
