Anti-Defensin like protein 2 antibody (ab225686)

Overview

  • Product name

    Anti-Defensin like protein 2 antibody
  • Description

    Rabbit polyclonal to Defensin like protein 2
  • Host species

    Rabbit
  • Specificity

    Predicted to react with Raphanus sativus (Radish) (100% sequence identity).
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Species independent
  • Immunogen

    Recombinant full length protein corresponding to Defensin like protein 2 aa 30-80. Raphanus sativus (Radish).
    Sequence:

    QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFP C


    Database link: P30230

  • Positive control

    • WB: Recombinant Raphanus sativus Defensin-like protein 2 protein

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab225686 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 22 kDa (predicted molecular weight: 22 kDa).

This antibody has only been tested in WB using the recombinant protein, we have no data for endogenous protein.

Images

  • All lanes : Anti-Defensin like protein 2 antibody (ab225686) at 1/500 dilution

    Lane 1 : Recombinant Raphanus sativus Defensin-like protein 2 protein, 100 ng
    Lane 2 : Recombinant Raphanus sativus Defensin-like protein 2 protein, 50 ng
    Lane 3 : Recombinant Raphanus sativus Defensin-like protein 2 protein, 25 ng

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 22 kDa
    Observed band size: 22 kDa



    This antibody has only been tested in WB using the recombinant protein, we have no data for endogenous protein.

References

ab225686 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225686.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up