Overview

  • Product name

  • Description

    Rabbit polyclonal to DEGA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Human DEGA aa 45-95 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    CICATDIVSCTNKNLSKVPGNLFRLIKRLDLSYNRIGLLDSEWIPVSFAK L


    Database link: Q86SJ2

  • Positive control

    • IHC-P: Mouse placenta tissue.
  • General notes

    Previously labelled as AMIGO2. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab216591 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Required for depolarization-dependent survival of cultured cerebellar granule neurons. May mediate homophilic as well as heterophilic cell-cell interaction with AMIGO1 or AMIGO3. May contribute to signal transduction through its intracellular domain. May be required for tumorigenesis of a subset of gastric adenocarcinomas.
  • Tissue specificity

    Highest levels in breast, ovary, cervix, and uterus. Lower levels in lung, colon, and rectum. Differentially expressed in 56% of thyroid, 57% of pancreatic and 45% of stomach cancers.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. AMIGO family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 6 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 LRRNT domain.
  • Cellular localization

    Cell membrane. Nucleus. Associated with nucleus as well as plasma membrane. Restricted to somata of cerebellar as well as hippocampal neurons.
  • Information by UniProt
  • Database links

  • Alternative names

    • Adhesion molecule with Ig like domain 2 antibody
    • ALI 1 antibody
    • ALI1 antibody
    • Alivin 1 antibody
    • Alivin-1 antibody
    • Alivin1 antibody
    • AMGO2_HUMAN antibody
    • AMIGO 2 antibody
    • AMIGO-2 antibody
    • Amigo2 antibody
    • Amphoterin induced gene 2 antibody
    • Amphoterin induced protein 2 antibody
    • Amphoterin-induced gene and open reading frame 2 antibody
    • Amphoterin-induced protein 2 antibody
    • DEGA antibody
    • Differentially expressed in gastric adenocarcinoma antibody
    • Differentially expressed in gastric adenocarcinomas antibody
    • Transmembrane protein AMIGO 2 antibody
    • Transmembrane protein AMIGO2 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded mouse placenta tissue, labeling DEGA using ab216591 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab216591 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216591.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up