Overview

  • Product name

    Dendrotoxin-K, KV1.1 blocker
  • Description

    Highly selective, potent KV1.1 blocker
  • Biological description

    Highly selective, potent KV1.1 blocker. Exclusively blocks the single cloned KV1.1 channels as opposed to dendrotoxins I, α, β and γ (Asc 1791, 1792, 1793 and 1794). Differentially blocks heteromers of KV1.1/1.X with variable affinity in different neuronal subtypes.
  • Purity

    > 98%
  • CAS Number

    119128-61-9
  • Chemical structure

    Chemical Structure

Properties

  • Molecular weight

    6560.00
  • Molecular formula

    C294H462N84O75S6
  • Sequence

    AAKYCKLPLRIGPCKRKIPSFYYKWKAKQCLPFDYSGCGGNANRFKTIEECRRTCVG (Modifications: Disulfide bonds: 5-55, 14-38, 30-51)
  • Storage instructions

    Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.
  • Solubility overview

    Soluble in water
  • Handling

    Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

    Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

  • Source

    Dendroaspis polylepis polylepis (Black mamba).

  • Research areas

Images

  • Dendrotoxin-K inhibits KV1.1 channel currents heterologously expressed in Xenopus oocytes.

    A.Time course at plateau of Dendrotoxin-K (ab141795) action on KV1.1 currents. Current amplitude at plateau was plotted as a function of time. Membrane potential was held at -80 mV and oocytes were stimulated by a 100 ms voltage ramp to -10 mV. 1 nM Dendrotoxin-K (applied for 2 min, green) were perfused during the period marked by the bar, (as indicated) and showed 70-80% inhibition of control current. B. Superimposed traces of channel current in the absence (black) and presence (green) of 1 nM Dendrotoxin-K (taken from experiment in A).

References

This product has been referenced in:

  • Teichert RW  et al. Functional profiling of neurons through cellular neuropharmacology. Proc Natl Acad Sci U S A 109:1388-95 (2012). Read more (PubMed: 22307590) »
  • Wang FC  et al. Identification of residues in dendrotoxin K responsible for its discrimination between neuronal K+ channels containing Kv1.1 and 1.2 alpha subunits. Eur J Biochem 263:222-9 (1999). Read more (PubMed: 10429207) »
  • Robertson B  et al. Novel effects of dendrotoxin homologues on subtypes of mammalian Kv1 potassium channels expressed in Xenopus oocytes. FEBS Lett 383:26-30 (1996). Read more (PubMed: 8612784) »

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab141795.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES, NOT FOR USE IN HUMANS"
For licensing inquiries, please contact partnerships@abcam.com

Sign up