Overview

  • Product name

  • Description

    Rabbit polyclonal to DEP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human DEP1 aa 850-890 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    YAVILTTGEAGHPSADVLKYTYEDFKKGASDTYVTYLIRTE


    Database link: Q12913

  • Positive control

    • Human colon carcinoma tissue. Human lung carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab202958 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 146 kDa.
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Use at 1/50 - 1/200 with fluorescent detection methods.

Target

  • Function

    Tyrosine phosphatase which dephosphorylates or contributes to the dephosphorylation of CTNND1, PDGFRB, MET, RET (variant MEN2A), KDR, LYN, SRC, MAPK1, MAPK3, EGFR, TJP1, OCLN, PIK3R1 and PIK3R2. Plays a role in cell adhesion, migration, proliferation and differentiation. Involved in vascular development. Regulator of macrophage adhesion and spreading. Positively affects cell-matrix adhesion. Positive regulator of platelet activation and thrombosis. Negative regulator of cell proliferation. Negative regulator of PDGF-stimulated cell migration; through dephosphorylation of PDGFR. Positive regulator of endothelial cell survival, as well as of VEGF-induced SRC and AKT activation; through KDR dephosphorylation. Negative regulator of EGFR signaling pathway; through EGFR dephosphorylation. Enhances the barrier function of epithelial junctions during reassembly. Negatively regulates T-cell receptor (TCR) signaling. Upon T-cell TCR activation, it is up-regulated and excluded from the immunological synapses, while upon T-cell-antigen presenting cells (APC) disengagement, it is no longer excluded and can dephosphorylate PLCG1 and LAT to down-regulate prolongation of signaling.
  • Tissue specificity

    Expressed in the promyelocytic cell line HL60, the granulocyte-macrophage colony-stimulating factor-dependent leukemic cell line F-36P, and the interleukin-3 and erythropoietin-dependent leukemic cell line F-36E. Expressed predominantly in epithelial cells and lymphocytes. Enhanced expression at high cell density.
  • Sequence similarities

    Belongs to the protein-tyrosine phosphatase family. Receptor class 3 subfamily.
    Contains 9 fibronectin type-III domains.
    Contains 1 tyrosine-protein phosphatase domain.
  • Post-translational
    modifications

    N- and O-glycosylated.
  • Cellular localization

    Cell membrane. Cell projection > ruffle membrane. Cell junction. After T cell stimulation, it is temporarily excluded from immunological synapses.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD 148 antibody
    • CD148 antibody
    • CD148 antigen antibody
    • Density enhanced phosphatase 1 antibody
    • Density-enhanced phosphatase 1 antibody
    • DEP 1 antibody
    • DEP-1 antibody
    • HPTP eta antibody
    • HPTPeta antibody
    • Human density enhanced phosphatase 1 antibody
    • Protein tyrosine phosphatase eta antibody
    • Protein tyrosine phosphatase receptor type J antibody
    • Protein tyrosine phosphatase receptor type J polypeptide antibody
    • Protein-tyrosine phosphatase eta antibody
    • Protein-tyrosine phosphatase receptor type J antibody
    • PTPJ antibody
    • Ptprj antibody
    • PTPRJ_HUMAN antibody
    • R PTP Eta antibody
    • R-PTP-eta antibody
    • R-PTP-J antibody
    • Receptor type tyrosine protein phosphatase eta antibody
    • Receptor-type tyrosine-protein phosphatase eta antibody
    • SCC 1 antibody
    • SCC1 antibody
    • susceptibility to colon cancer 1, mouse, homolog of antibody
    see all

Images

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded human lung carcinoma tissue sections labeling DEP1 with ab202958 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded human colon carcinoma tissue sections labeling DEP1 with ab202958 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

This product has been referenced in:

  • Tsagianni A  et al. Combined Systemic Disruption of MET and Epidermal Growth Factor Receptor Signaling Causes Liver Failure in Normal Mice. Am J Pathol 188:2223-2235 (2018). Read more (PubMed: 30031724) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202958.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up