Overview

  • Product name

  • Description

    Rabbit polyclonal to DEPDC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DEPDC1 aa 38-248.
    Sequence:

    KKYGNCFTAGEAVDWLYDLLRNNSNFGPEVTRQQTIQLLRKFLKNHVIED IKGRWGSENVDDNNQLFRFPATSPLKTLPRRYPELRKNNIENFSKDKDSI FKLRNLSRRTPKRHGLHLSQENGEKIKHEIINEDQENAIDNRELSQEDVE EVWRYVILIYLQTILGVPSLEEVINPKQVIPQYIMYNMANTSKRGVVILQ NKSDDLPHWVL


    Database link: Q5TB30

  • Positive control

    • HeLa lysate; Human fetal pancreas tissue.

Properties

  • Form

    Lyophilised:Reconstitute in 200 uL sterile H2O.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab197246 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Predicted molecular weight: 93 kDa.

Target

  • Function

    May be involved in transcriptional regulation as a transcriptional corepressor. The DEPDC1A-ZNF224 complex may play a critical role in bladder carcinogenesis by repressing the transcription of the A20 gene, leading to transport of NF-KB protein into the nucleus, resulting in suppression of apoptosis of bladder cancer cells.
  • Tissue specificity

    Expressed in testis. Up-regulated in bladder cancer cells (at protein level).
  • Sequence similarities

    Contains 1 DEP domain.
    Contains 1 Rho-GAP domain.
  • Cellular localization

    Nucleus. Co-localizes with ZNF224 at the nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5830484J08Rik antibody
    • Cell cycle control protein SDP35 antibody
    • DEP domain containing 1 antibody
    • DEP domain containing protein 1A antibody
    • DEP domain-containing protein 1A antibody
    • DEP.8 antibody
    • DEP1A_HUMAN antibody
    • DEPDC 1 antibody
    • DEPDC 1A antibody
    • DEPDC1 antibody
    • DEPDC1-V2 antibody
    • Depdc1a antibody
    • FLJ20354 antibody
    • SDP 35 antibody
    • SDP35 antibody
    see all

Images

  • Anti-DEPDC1 antibody (ab197246) at 1/500 dilution + HeLa lysate

    Predicted band size: 93 kDa

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded human fetal pancreas tissue labeling DEPDC1 with ab197246 at a 1/100 dilution.

References

ab197246 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197246.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up