Overview

  • Product name

    Anti-DEPDC1B antibody
  • Description

    Rabbit polyclonal to DEPDC1B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human DEPDC1B aa 343-529.
    Sequence:

    MPPLCDGFGTRTLMVQTFSRCILCSKDEVDLDELLAARLVTFLMDNYQEI LKVPLALQTSIEERVAHLRRVQIKYPGADMDITLSAPSFCRQISPEEFEY QRSYGSQEPLAALLEEVITDAKLSNKEKKKKLKQFQKSYPEVYQERFPTP ESAALLFPEKPKPKPQLLMWALKKPFQPFQRTRSFRM


    Database link: Q8WUY9-1

  • Positive control

    • IHC-P: Human testis and liver cancer tissues. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237542 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Relevance

    GTPase activator activity. biological process: intracellular signaling cascade
  • Cellular localization

    intracellular
  • Database links

  • Alternative names

    • BRCC3 antibody
    • Breast cancer cell 3 antibody
    • DEP domain containing 1B antibody
    • DEP domain containing protein 1B antibody
    • FLJ11252 antibody
    • HBV X transactivated gene 8 protein antibody
    • HBV X-transactivated gene 8 protein antibody
    • HBV XAg-transactivated protein 8 antibody
    • HBxAg transactivated protein 1 antibody
    • OTTHUMP00000122605 antibody
    • OTTHUMP00000221973 antibody
    • XTP1 antibody
    • XTP8 antibody
    see all

Images

  • HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for DEPDC1B (green) using ab237542 at 1/100 dilution in ICC/IF. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human testis tissue stained for DEPDC1B using ab237542 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver cancer tissue stained for DEPDC1B using ab237542 at 1/100 dilution in immunohistochemical analysis.

References

ab237542 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237542.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up