Overview

  • Product name

  • Description

    Rabbit polyclonal to DEPDC5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human DEPDC5 aa 462-548.
    Sequence:

    YDAQVFRLPGPSRAQCLTTCRSVRERESHSRKSASSCDVSSSPSLPSRTL PTEEVRSQASDDSSLGKSANILMIPHPHLHQYEVSSS


    Database link: O75140

  • Positive control

    • Human stomach tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab185565 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

Images

  • Ab185565 Immunofluorescent staining of human cell line HeLa shows positivity in the Golgi apparatus. Antibody staining is shown in green.

References

ab185565 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Application
Western blot
Sample
Mouse Tissue lysate - whole (Brain)
Gel Running Conditions
Reduced Denaturing (gel 3-8%)
Loading amount
50 µg
Specification
Brain
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C

Mr. Alexandre Bacq

Verified customer

Submitted Aug 03 2018

Abreviews
Application
Western blot
Sample
Human Cell lysate - whole cell (HepG2 knock down cells)
Gel Running Conditions
Reduced Denaturing (6% SDA PAGE)
Loading amount
60 µg
Specification
HepG2 knock down cells
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Mar 07 2018

Abreviews
Application
Western blot
Sample
Human Cell lysate - whole cell (MCF7, Breast cancer cells)
Gel Running Conditions
Reduced Denaturing (8 %)
Loading amount
50 µg
Specification
MCF7, Breast cancer cells
Blocking step
BSA as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: RT°C

Abcam user community

Verified customer

Submitted Jul 04 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up