Overview

  • Product name

    Anti-DEPP antibody
  • Description

    Rabbit polyclonal to DEPP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DEPP aa 33-104.
    Sequence:

    PSPSLDDYVRSISRLAQPTSVLDKATAQGQPRPPHRPAQACRKGRPAVSL RDITARFSGQQPTLPMADTVDP


    Database link: Q9NTK1

  • Positive control

    • Human urinary bladder tissue; U-2 OS cells.
  • General notes

     This product was previously labelled as C10orf10

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab204429 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May play a role in autophagy.
  • Tissue specificity

    Expressed in various tissues, including pancreas, placenta, ovary, testis and kidney.
  • Developmental stage

    High levels in first trimester deciduas. Higher levels in the endometria during secretory phase than the proliferative phase, especially after the mid-secretory phase.
  • Cellular localization

    Cytoplasm. May localize to aggresomes.
  • Information by UniProt
  • Database links

  • Alternative names

    • Decidual protein induced by progesterone antibody
    • Depp antibody
    • DEPP_HUMAN antibody
    • Fasting-induced gene protein antibody
    • FIG antibody
    • Protein DEPP antibody
    see all

Images

  • Immunofluorescent analysis of formalin fixed, Triton X-100 permealized U-2 OS cells labeling DEPP with ab204429 at 4 µg/ml (green).

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human urinary bladder tissue labeling DEPP with ab204429 at 1/200.

References

ab204429 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204429.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up