Overview

  • Product name

  • Description

    Rabbit polyclonal to Deptor
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human Deptor aa 210-309.
    Sequence:

    DSNLLYQFRMNFRRRRRLMELLNEKSPSSQETHDSPFCLRKQSHDNRKST SFMSVSPSKEIKIVSAVRRSSMSSCGSSGYFSSSPTLSSSPPVLCNPKSV


    Database link: Q8TB45

  • Positive control

    • ICC/IF: MCF7 cells. WB: Deptor overexpression HEK-293T cell lysate. IHC-P: Human skeletal muscle, fallopian tube and small intestine tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab244395 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • PFA-fixed, Triton X-100 permeabilized MCF7 (human breast adenocarcinoma cell line) cells stained for Deptor (green) using ab244395 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human small intestine tissue stained for Deptor using ab244395 at 1/50 dilution in immunohistochemical analysis.
  • Paraffin-embedded human fallopian tube tissue stained for Deptor using ab244395 at 1/50 dilution in immunohistochemical analysis.
  • Paraffin-embedded human skeletal muscle tissue stained for Deptor using ab244395 at 1/50 dilution in immunohistochemical analysis.
  • All lanes : Anti-Deptor antibody (ab244395) at 0.4 µg/ml

    Lane 1 : Vector only transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) lysate
    Lane 2 : Deptor overexpression HEK-293T cell lysate

References

ab244395 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244395.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up