Overview

  • Product name

    Anti-Desmocollin 3 antibody - C-terminal
    See all Desmocollin 3 primary antibodies
  • Description

    Rabbit polyclonal to Desmocollin 3 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Synthetic peptide corresponding to Human Desmocollin 3 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). (NP_001932)
    Sequence:

    WHSFTQPRLGEKLHRCNQNEDRMPSQDYVL


    Database link: Q14574

  • Positive control

    • Human placenta tissue; mouse spleen tissue lysate

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab190118 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 100 kDa.
IHC-P 1/100.

Target

  • Function

    Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. May contribute to epidermal cell positioning (stratification) by mediating differential adhesiveness between cells that express different isoforms.
  • Tissue specificity

    Epidermis, buccal mucosa, esophagus and cervix.
  • Involvement in disease

    Defects in DSC3 are the cause of hypotrichosis and recurrent skin vesicles (HRSV) [MIM:613102]. A disorder characterized by hypotrichosis and the appearance of recurrent skin vesicle formation. Affected individuals show sparse and fragile hair on scalp, as well as absent eyebrows and eyelashes. Vesicles filled with thin, watery fluid are observed on the scalp and skin of most of the boby. Mucosal vesicles are absent.
  • Sequence similarities

    Contains 5 cadherin domains.
  • Domain

    Calcium may be bound by the cadherin-like repeats.
  • Cellular localization

    Cell membrane. Cell junction > desmosome.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cadherin family member 3 antibody
    • CDHF3 antibody
    • desmocollin 3a/3b antibody
    • Desmocollin 4 antibody
    • Desmocollin-3 antibody
    • Desmocollin-4 antibody
    • Desmocollin3 antibody
    • Desmocollin4 antibody
    • DSC antibody
    • DSC1 antibody
    • DSC2 antibody
    • DSC3 antibody
    • DSC3_HUMAN antibody
    • DSC4 antibody
    • HT CP antibody
    • HT-CP antibody
    • HTCP antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human placenta tissue, labeling Desmocollin 3 with ab190118 at 1/100 dilution.

  • Anti-Desmocollin 3 antibody - C-terminal (ab190118) at 1/1000 dilution + mouse spleen tissue lysate at 35 µg

    Predicted band size: 100 kDa

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190118.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up