Overview

  • Product name

    Anti-Desmoglein 3/PVA antibody
    See all Desmoglein 3/PVA primary antibodies
  • Description

    Rabbit polyclonal to Desmoglein 3/PVA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment corresponding to Human Desmoglein 3/PVA aa 858-999. N-terminal His-tag and GST-tags (Expressed in E.coli).
    Sequence:

    EISLGVDGEGKEVQPPSKDSGYGIESCGHPIEVQQTGFVKCQTLSGSQGA SALSTSGSVQPAVSIPDPLQHGNYLVTETYSASGSLVQPSTAGFDPLLTQ NVIVTERVICPISSVPGNLAGPTQLRGSHTMLCTEDPCSRLI


    Database link: P32926

  • Positive control

    • Pig skin tissue; Recombinant human Desmoglein 3/PVA protein.
  • General notes

    Previously labelled as Desmoglein 3. 

Properties

Applications

Our Abpromise guarantee covers the use of ab231947 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 1 - 5 µg/ml.

Target

  • Function

    Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion.
  • Tissue specificity

    Epidermis, tongue, tonsil, esophagus and carcinomas.
  • Sequence similarities

    Contains 4 cadherin domains.
  • Domain

    Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain.
  • Cellular localization

    Cell membrane. Cell junction > desmosome.
  • Information by UniProt
  • Database links

  • Alternative names

    • 130 kD pemphigus vulgaris antigen antibody
    • 130 kDa pemphigus vulgaris antigen antibody
    • Balding antibody
    • Cadherin family member 6 antibody
    • CDHF 6 antibody
    • CDHF6 antibody
    • Desmoglein 3 antibody
    • Desmoglein 3 precursor antibody
    • Desmoglein-3 antibody
    • Desmoglein3 antibody
    • DKFZp686P23184 antibody
    • DSG 3 antibody
    • DSG3 antibody
    • DSG3_HUMAN antibody
    • Pemphigus vulgaris antigen antibody
    • PVA antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human placenta tissues staining Desmoglein 3/PVA antibody at ab231947 20 µg/mL
  • Anti-Desmoglein 3/PVA antibody (ab231947) at 2 µg/ml + Recombinant human Desmoglein 3/PVA protein.
  • Anti-Desmoglein 3/PVA antibody (ab231947) at 3 µg/ml + Pig skin tissue lysate.

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

References

ab231947 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231947.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up