Overview

  • Product name

    Anti-Desmuslin/SYN antibody
    See all Desmuslin/SYN primary antibodies
  • Description

    Rabbit polyclonal to Desmuslin/SYN
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human Desmuslin/SYN aa 510-550 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    RNRPETIRTKPEEKMFDSKEKASEERNLRWEELTKLDKEAR


    Database link: O15061

  • Positive control

    • Rat heart and skeletal tissues.
  • General notes

     This product was previously labelled as Desmuslin

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab214316 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Type-VI intermediate filament (IF) which plays an important cytoskeletal role within the muscle cell cytoskeleton. It forms heteropolymeric IFs with desmin and/or vimentin, and via its interaction with cytoskeletal proteins alpha-dystrobrevin, dystrophin, talin-1, utrophin and vinculin, is able to link these heteropolymeric IFs to adherens-type junctions, such as to the costameres, neuromuscular junctions, and myotendinous junctions within striated muscle cells.
  • Tissue specificity

    Isoform 2 is strongly detected in adult heart, fetal skeletal muscles and fetal heart. Isoform 1 is weakly detected in fetal heart and also in fetal skeletal muscle. Isoform 1 and isoform 2 are detected in adult bladder (at protein level). The mRNA is predominantly expressed in heart and muscle with some expression in brain which may be due to tissue-specific isoforms.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Developmental stage

    In lens, first detected at 16 weeks when expression is weakly and uniformly distributed. Subsequently, expression becomes much stronger in the epithelium of the anterior part at 25 weeks and later. In retina, weakly expressed at 15 weeks in the nerve fiber and ganglion cell layers (NFL and GCL). From 25 weeks onwards, much stronger expression is observed in the endfeet of Mueller cells, the NFL, and GCL, and much lower expression is observed in a minor subpopulation of cells in the inner cell layer (INL). At 30 and 36 weeks, expression remains in the neural retina, and subsequently becomes stronger in the NFL, GCL, and INL and is decreased in Mueller cells. At 36 weeks, also expressed at the external border of the outer nuclear layer (ONL) (at protein level).
  • Cellular localization

    Cytoplasm, cytoskeleton. Cell junction, adherens junction. There are at least two distinct SYNM subpopulations, one in which SYMN interacts with DES within the Z-lines, and another in which it interacts with both DTNA and DES at the costamere.
  • Information by UniProt
  • Database links

  • Alternative names

    • Desmuslin antibody
    • DMN antibody
    • KIAA0353 antibody
    • SYN antibody
    • SYNEM_HUMAN antibody
    • Synemin alpha antibody
    • Synemin antibody
    • Synemin beta antibody
    • Synemin, intermediate filament protein antibody
    • SYNM antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling Desmuslin/SYN with ab214316 at 1/4200 dilution, followed by FITC conjugated secondary antibody.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat heart tissue labeling Desmuslin/SYN with ab214316 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab214316 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214316.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up