Overview

  • Product name

  • Description

    Rabbit polyclonal to DFNA5/GSDME
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DFNA5/GSDME aa 317-466.
    Sequence:

    VLFDDELLMVLEPVCDDLVSGLSPTVAVLGELKPRQQQDLVAFLQLVGCS LQGGCPGPEDAGSKQLFMTAYFLVSALAEMPDSAAALLGTCCKLQIIPTL CHLLRALSDDGVSDLEDPTLTPLKDTERFGIVQRLFASADISLERLKSSV


    Database link: O60443

  • Positive control

    • IHC-P: Human placenta tissue. WB: RT4 and U-251 MG cell lysate. ICC/IF: A431 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab244323 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Tissue specificity

    Expressed in cochlea. Low level of expression in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas, with highest expression in placenta.
  • Involvement in disease

    Defects in DFNA5 are the cause of deafness autosomal dominant type 5 (DFNA5) [MIM:600994]. DFNA5 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information.
  • Sequence similarities

    Belongs to the gasdermin family.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2310037D07Rik antibody
    • 4932441K13Rik antibody
    • Deafness, autosomal dominant 5 antibody
    • Deafness, autosomal dominant 5 protein antibody
    • DFNA5 antibody
    • DFNA5 gene antibody
    • DFNA5_HUMAN antibody
    • Dfna5h antibody
    • EG14210 antibody
    • Fin15 antibody
    • ICERE 1 antibody
    • ICERE-1 antibody
    • Inversely correlated with estrogen receptor expression 1 antibody
    • Non-syndromic hearing impairment protein 5 antibody
    • Nonsyndromic hearing impairment protein antibody
    see all

Images

  • PFA fixed, Triton X-100 permeabilized A431 (Human epidermoid carcinoma cell line) cells labeling DFNA5/GSDME using ab244323 at 4 µg/ml (green) in ICC/IF.

  • Formalin-fixed, paraffin-embedded human placenta tissue stained for DFNA5/GSDME with ab244323 at a 1/20 dilution in immunohistochemical analysis.

  • All lanes : Anti-DFNA5/GSDME antibody (ab244323) at 0.4 µg/ml

    Lane 1 : RT4 (Human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (Human brain glioma cell line) cell lysate

References

ab244323 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244323.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up