Overview

  • Product name

    Anti-DGAT2L4 antibody
  • Description

    Rabbit polyclonal to DGAT2L4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human DGAT2L4 aa 218-267.
    Sequence:

    PLIPAYAFGETDLYDQHIFTPGGFVNRFQKWFQSMVHIYPCAFYGRGFTK


    Database link: Q6E213

  • Positive control

    • Huma skin tissue

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204904 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Acyltransferase that predominantly esterify long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that it plays a central role in lipid metabolism in skin. Has no activity using decyl alcohol and significantly prefers the C16 and C18 alcohols. May also have 2-acylglycerol O-acyltransferase (MGAT) and acyl-CoA:retinol acyltransferase (ARAT) activities, to catalyze the synthesis of diacylglycerols and retinyl esters; however this activity is unclear in vivo.
  • Tissue specificity

    Abundant in tissues rich in sebaceous glands such as the preputial gland and eyelid. Highly expressed in skin, where it is primarily restricted to undifferentiated peripheral sebocytes. Also expressed at lower level in other tissues except pancreas.
  • Sequence similarities

    Belongs to the diacylglycerol acyltransferase family.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acyl CoA wax alcohol acyltransferase 2 antibody
    • Acyl-CoA retinol O-fatty-acyltransferase antibody
    • Acyl-CoA wax alcohol acyltransferase 2 antibody
    • ARAT antibody
    • Awat2 antibody
    • AWAT2_HUMAN antibody
    • DC4 antibody
    • Diacylglycerol O acyltransferase 2 like 4 antibody
    • Diacylglycerol O acyltransferase candidate 4 antibody
    • Diacylglycerol O-acyltransferase 2-like protein 4 antibody
    • Diacylglycerol O-acyltransferase candidate 4 antibody
    • hDC4 antibody
    • hWS antibody
    • Long chain alcohol O fatty acyltransferase 2 antibody
    • Long-chain-alcohol O-fatty-acyltransferase 2 antibody
    • MFAT antibody
    • Multifunctional O acyltransferase antibody
    • Multifunctional O-acyltransferase antibody
    • Retinol O-fatty-acyltransferase antibody
    • Wax synthase 2 antibody
    • Wax synthase antibody
    • WS antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded human skin tissue labeling DGAT2L4 with ab204904 at a dilution of 1/1000.

References

This product has been referenced in:

  • Singh K  et al. JunB defines functional and structural integrity of the epidermo-pilosebaceous unit in the skin. Nat Commun 9:3425 (2018). Read more (PubMed: 30143626) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204904.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up