Overview

  • Product name

  • Description

    Rabbit polyclonal to DGKA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Pig
  • Immunogen

    Recombinant fragment corresponding to Human DGKA aa 141-337.
    Sequence:

    QMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPL LVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKY TVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIR IYHSLTGLHCVWCHLEIHDDCLQAVGHECD CGLLRDHILPPSSIYPS


    Database link: P23743

  • Positive control

    • Jurkat and HeLa lysates; Human fetal tonsil tissue.

Properties

  • Form

    Lyophilised:Reconstitute in 200ul sterile H2O. If this product is received as liquid it has already been reconstituted.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab197249 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 83 kDa.
IHC-P 1/100 - 1/500.

Target

  • Function

    Upon cell stimulation converts the second messenger diacylglycerol into phosphatidate, initiating the resynthesis of phosphatidylinositols and attenuating protein kinase C activity.
  • Tissue specificity

    Lymphocytes and oligodendroglial cells.
  • Sequence similarities

    Belongs to the eukaryotic diacylglycerol kinase family.
    Contains 1 DAGKc domain.
    Contains 2 EF-hand domains.
    Contains 2 phorbol-ester/DAG-type zinc fingers.
  • Information by UniProt
  • Database links

  • Alternative names

    • 80 kDa diacylglycerol kinase antibody
    • DAG kinase alpha antibody
    • DAGK antibody
    • DAGK1 antibody
    • DGK alpha antibody
    • DGK-alpha antibody
    • dgkA antibody
    • DGKA_HUMAN antibody
    • Diacylglycerol kinase alpha antibody
    • Diacylglycerol kinase, alpha 80kDa antibody
    • Diglyceride kinase alpha antibody
    • MGC12821 antibody
    • MGC42356 antibody
    • OTTHUMP00000242836 antibody
    • OTTHUMP00000242955 antibody
    • OTTHUMP00000244046 antibody
    see all

Images

  • All lanes : Anti-DGKA antibody (ab197249) at 1/500 dilution

    Lane 1 : Jurkat lysate
    Lane 2 : HeLa lysate

    Predicted band size: 83 kDa

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human fetal tonsil tissue labeling DGKA with ab197249 at 1/100.

References

This product has been referenced in:

  • Karachaliou N  et al. BIM and mTOR expression levels predict outcome to erlotinib in EGFR-mutant non-small-cell lung cancer. Sci Rep 5:17499 (2015). WB ; Human . Read more (PubMed: 26639561) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197249.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up