Overview

  • Product name

  • Description

    Rabbit polyclonal to DGKE
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Synthetic peptide within Human DGKE aa 30-80 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    VLLPVFITFWCSLQRSRRQLHRRDIFRKSKHGWRDTDLFSQPTYCCVCAQ H


    Database link: P52429

  • Positive control

    • Mouse testis lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab218039 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 64 kDa.

Target

  • Function

    Highly selective for arachidonate-containing species of diacylglycerol (DAG). May terminate signals transmitted through arachidonoyl-DAG or may contribute to the synthesis of phospholipids with defined fatty acid composition.
  • Tissue specificity

    Expressed predominantly in testis.
  • Sequence similarities

    Belongs to the eukaryotic diacylglycerol kinase family.
    Contains 1 DAGKc domain.
    Contains 2 phorbol-ester/DAG-type zinc fingers.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AHUS7 antibody
    • DAG kinase epsilon antibody
    • DAGK 5 antibody
    • DAGK 6 antibody
    • DAGK5 antibody
    • DAGK6 antibody
    • DGK antibody
    • DGK epsilon antibody
    • DGK-epsilon antibody
    • DGKE antibody
    • DGKE_HUMAN antibody
    • Diacylglycerol kinase epsilon 64kDa antibody
    • Diacylglycerol kinase epsilon antibody
    • Diglyceride kinase epsilon antibody
    • NPHS7 antibody
    see all

Images

  • Anti-DGKE antibody (ab218039) at 1/300 dilution + mouse testis lysates

    Developed using the ECL technique.

    Predicted band size: 64 kDa

References

ab218039 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218039.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up