Overview

  • Product name

  • Description

    Rabbit polyclonal to DGKH
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human DGKH aa 50-100 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    KLIRKVSTSGQIRTKTSIKEGQLLKQTSSFQRWKKRYFKLRGRTLYYAKD S


    Database link: Q86XP1

  • Positive control

    • Raji cell lysate; Human colon carcinoma tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab217208 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200.
WB 1/100 - 1/1000. Predicted molecular weight: 135 kDa.

Target

  • Relevance

    This gene encodes a member of the diacylglycerol kinase (DGK) enzyme family of proteins, specifically the type II DGK subfamily. Members of this family are involved in regulating the intracellular concentrations of diacylglycerol and phosphatidic acid. Two transcript variants encoding distinct isoforms have been identified for this gene.
  • Cellular localization

    Cytoplasm. Translocated from the cytoplasm to endosomes in response to stress stimuli. Isoform 2 is rapidly relocated back to the cytoplasm upon removal of stress stimuli, whereas isoform 1 exhibits sustained endosomal association.
  • Database links

  • Alternative names

    • DAG kinase eta antibody
    • DGK eta antibody
    • Diacylglycerol kinase eta antibody
    • Diglyceride kinase eta antibody

Images

  • Anti-DGKH antibody (ab217208) at 1/300 dilution + Raji cell lysate

    Secondary
    Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated at 1/5000 dilution

    Predicted band size: 135 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human colon carcinoma tissue labeling DGKH with ab217208 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab217208 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217208.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up