Anti-DHDDS antibody - C-terminal (ab224125)

Overview

  • Product name

    Anti-DHDDS antibody - C-terminal
    See all DHDDS primary antibodies
  • Description

    Rabbit polyclonal to DHDDS - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DHDDS aa 251-333 (C terminal).
    Sequence:

    HSVLQKARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLH KLSARREERVQGFLQALELKRADWLARLGTASA


    Database link: Q86SQ9

  • Positive control

    • IHC-P: Human epididymis tissue.
  • General notes

    Previously labelled as Dehydrodolichyl Diphosphate Synthase. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab224125 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    Catalyzes cis prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several classes of glycoprotein.
  • Database links

  • Alternative names

    • cis-IPTase antibody
    • Cis-isoprenyltransferase antibody
    • cis-prenyl transferase antibody
    • CIT antibody
    • CPT antibody
    • Dedol PP synthase antibody
    • dedol-PP synthase antibody
    • dehydrodolichyl diphosphate synthase antibody
    • DHDDS antibody
    • DS antibody
    • Epididymis tissue protein Li 189m antibody
    • HDS antibody
    • RP3-476K8.2 antibody
    • RP59 antibody
    see all

Images

  • Paraffin-embedded human epididymis tissue stained for DHDDS using ab224125 at 1/50 dilution in immunohistochemical analysis.

References

ab224125 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224125.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up