Overview

  • Product name

  • Description

    Rabbit polyclonal to DHFRL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DHFRL1 aa 2-186.
    Sequence:

    FLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLV IMGRKTWFSIPEKNRPLKDRINLVLSRELKEPPQGAHFLARSLDDALKLT ERPELANKVDMIWIVGGSSVYKEAMNHLGHLKLFVTRIMQDFESDTFFSE IDLEKYKLLPEYPGVLSDVQEGKHIKYKFEVCEKD


    Database link: Q86XF0

  • Positive control

    • HeLa, HEK293 and MCF7 cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab197258 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Predicted molecular weight: 22 kDa.

Target

  • Relevance

    May play a role in folate metabolism. Belongs to the dihydrofolate reductase family.
  • Cellular localization

    Mitochondrion inner membrane
  • Database links

  • Alternative names

    • DHFRP4 antibody
    • Dihydrofolate reductase like 1 antibody
    • Dihydrofolate reductase pseudogene 4 antibody

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human fetal tissue labelling DHFRL1 with ab197258 at a dilution of 1/100.

  • All lanes : Anti-DHFRL1 antibody (ab197258) at 1/500 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : HEK293 cell lysate
    Lane 3 : MCF7 cell lysate

    Predicted band size: 22 kDa

References

ab197258 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197258.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up