Overview

  • Product name

    Anti-DHHC-15 antibody
  • Description

    Rabbit polyclonal to DHHC-15
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DHHC-15 aa 238-322 (internal sequence).
    Sequence:

    VSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGS SPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQ

  • Positive control

    • Human pancreas tissue; Human liver lysate.
  • General notes

    Previously labelled as ZDHHC15.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab121203 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

Target

  • Function

    Palmitoyltransferase specific for GAP43 and DLG4/PSD95.
  • Tissue specificity

    Expressed in placenta, liver, lung, kidney, heart and brain.
  • Involvement in disease

    Defects in ZDHHC15 are the cause of mental retardation X-linked type 91 (MRX91) [MIM:300577]. Mental retardation is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Non-syndromic mental retardation patients do not manifest other clinical signs.
  • Sequence similarities

    Belongs to the DHHC palmitoyltransferase family.
    Contains 1 DHHC-type zinc finger.
  • Domain

    The DHHC domain is required for palmitoyltransferase activity.
  • Post-translational
    modifications

    Autopalmitoylated.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • DHHC-15 antibody
    • Palmitoyltransferase ZDHHC15 antibody
    • UNQ1969/PRO4501 antibody
    • ZDH15_HUMAN antibody
    • Zdhhc15 antibody
    • Zinc finger DHHC domain-containing protein 15 antibody
    see all

Images

  • Immunofluorescent staining of Human cell line U-2 OS shows positivity in nucleus but not nucleoli and cytoplasm. Recommended concentration of ab121203 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • ab121203 at 1/5 dilution staining DHHC-15 in Paraffin-embedded Human Pancreas tissue by Immunohistochemistry.

  • All lanes : Anti-DHHC-15 antibody (ab121203) at 1/250 dilution

    Lane 1 : RT 4 cell lysate
    Lane 2 : U 251 MG cell lysate
    Lane 3 : A431 cell lysate
    Lane 4 : Human Liver cell lysate
    Lane 5 : Human tonsil cell lysate

References

ab121203 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Sample
Rat Cell (primary hippocampal neurons)
Permeabilization
Yes - 0.3% triton X 100
Specification
primary hippocampal neurons
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 24°C
Fixative
Paraformaldehyde

Dr. Bhavin Shah

Verified customer

Submitted Apr 09 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up