Overview

  • Product name

  • Description

    Rabbit polyclonal to DHHC-5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog, Chimpanzee, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human DHHC-5 aa 492-623.
    Sequence:

    DPPLGYTSPFLSARLAQQREAERHPRLVPTGPTHREPSPVRYDNLSRHIV ASLQEREKLLRQSPPLPGREEEPGLGDSGIQSTPGSGHAPRTSSSSDDSK RSPLGKTPLGRPAVPRFGKPDGLRGRGVGSPE


    Database link: Q9C0B5

  • Positive control

    • IHC-P: Human gallbladder tissue. ICC/IF: A431 cells.
  • General notes

    Previously labelled as ZDHHC5.

Properties

Applications

Our Abpromise guarantee covers the use of ab224093 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/permeabilization: PFA/Triton X-100.

Target

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for DHHC-5 (green) using ab224093 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human gallbladder tissue stained for DHHC-5 using ab224093 at 1/50 dilution in immunohistochemical analysis.

References

ab224093 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224093.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up