Overview

  • Product name

  • Description

    Rabbit polyclonal to DHODH
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human DHODH aa 238-348.
    Sequence:

    QERDALRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVS RPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSS GQDALEKIRAG


    Database link: Q02127

  • Positive control

    • IHC-P: Human kidney tissue. WB: DHODH over expressed HEK-239T lysate. ICC/IF: MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab246893 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 42 kDa.

Target

  • Function

    Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.
  • Pathway

    Pyrimidine metabolism; UMP biosynthesis via de novo pathway; orotate from (S)-dihydroorotate (quinone route): step 1/1.
  • Involvement in disease

    Defects in DHODH are the cause of postaxial acrofacial dysostosis (POADS) [MIM:263750]; also known as Miller syndrome. POADS is characterized by severe micrognathia, cleft lip and/or palate, hypoplasia or aplasia of the posterior elements of the limbs, coloboma of the eyelids and supernumerary nipples. POADS is a very rare disorder: only 2 multiplex families, each consisting of 2 affected siblings born to unaffected, nonconsanguineous parents, have been described among a total of around 30 reported cases.
  • Sequence similarities

    Belongs to the dihydroorotate dehydrogenase family. Type 2 subfamily.
  • Post-translational
    modifications

    The uncleaved transit peptide is required for mitochondrial targeting and proper membrane integration.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • DHOdehase antibody
    • Dhodh antibody
    • Dihydroorotate dehydrogenase (quinone) antibody
    • Dihydroorotate dehydrogenase antibody
    • Dihydroorotate dehydrogenase mitochondrial antibody
    • Dihydroorotate oxidase antibody
    • Human complement of yeast URA1 antibody
    • mitochondrial antibody
    • POADS antibody
    • PYRD_HUMAN antibody
    • URA1 antibody
    see all

Images

  • All lanes : Anti-DHODH antibody (ab246893) at 0.4 µg

    Lane 1 : Vector only-transfected HEK-293T cell lysate
    Lane 2 : DHODH over-expression HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Predicted band size: 42 kDa



    Western blot analysis in control (vector only transfected HEK293T lysate) and DHODH over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419975).
  • PFA-fixed, Triton X-100 permeabilized MCF7 (human breast adenocarcinoma cell line) cells stained for DHOHD (green) using ab246893 at 4 μg/ml in ICC/IF.

  • Paraffin-embedded human kidney tissue stained for DHODH using ab246893 at 1/20 dilution in immunohistochemical analysis.

References

ab246893 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246893.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up