Overview

  • Product name

  • Description

    Rabbit polyclonal to DHPS/DHS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human DHPS/DHS aa 1-369.
    Sequence:

    MEGSLEREAPAGALAAVLKHSSTLPPESTQVRGYDFNRGVNYRALLEAFG TTGFQATNFG RAVQQVNAMIEKKLEPLSQDEDQHADLTQSRRPLTSCT IFLGYTSNLISSGIRETIRYLV QHNMVDVLVTTAGGVEEDLIKCLAPT YLGEFSLRGKELRENGINRIGNLLVPNENYCKFE DWLMPILDQMVMEQ NTEGVKWTPSKMIARLGKEINNPESVYYWAQKNHIPVFSPALTDGS LG DMIFFHSYKNPGLVLDIVEDLRLINTQAIFAKCTGMIILGGGVVKHHIAN ANLMRNGA DYAVYINTAQEFDGSDSGARPDEAVSWGKIRVDAQPVKVY ADASLVFPLLVAETFAQKMD AFMHEKNED


    Database link: P49366

  • Positive control

    • Skeletal Muscle (Mouse) Whole Cell Lysate (ab3869) can be used as a positive control in WB. MCF7, BT474, 293T, Jurkat, SGC7901, mouse testis, mouse brain, mouse skeletal muscle and rat brain cell extracts.
  • General notes

    Protein previously labeled as DHPS.

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab202133 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 41 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • All lanes : Anti-DHPS/DHS antibody (ab202133) at 1/500 dilution

    Lane 1 : MCF7 cell extract
    Lane 2 : BT474 cell extract
    Lane 3 : 293T cell extract
    Lane 4 : Jurkat cell extract
    Lane 5 : SGC7901 cell extract
    Lane 6 : Mouse testis cell extract
    Lane 7 : Mouse brain cell extract
    Lane 8 : Mouse skeletal muscle cell extract
    Lane 9 : Rat brain cell extract

    Developed using the ECL technique.

    Predicted band size: 41 kDa

References

This product has been referenced in:

  • Imam S  et al. eIF5A inhibition influences T cell dynamics in the pancreatic microenvironment of the humanized mouse model of Type 1 Diabetes. Sci Rep 9:1533 (2019). Read more (PubMed: 30733517) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202133.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up