Anti-DHRS12 antibody - C-terminal (ab177968)

Overview

  • Product name
    Anti-DHRS12 antibody - C-terminal
    See all DHRS12 primary antibodies
  • Description
    Rabbit polyclonal to DHRS12 - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Synthetic peptide within Human DHRS12 aa 173-222 (C terminal). The exact sequence is proprietary. NP_001257353
    Sequence:

    VSSGGMLVQKLNTNDLQSERTPFDGTMVYAQNKRQQVVLTERWAQGHPAI


    Database link: A0PJE2

  • Positive control
    • Human fetal liver lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab177968 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 35 kDa.

Target

  • Relevance
    Putative oxidoreductase. Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Database links
  • Alternative names
    • dehydrogenase/reductase (SDR family) member 12 antibody
    • Dehydrogenase/reductase SDR family member 12 antibody
    • DHRS12 antibody
    • FLJ13639 antibody
    • SDR40C1 antibody
    • short chain dehydrogenase/reductase family 40C, member 1 antibody
    • short-chain dehydrogenase/reductase, family member 12 antibody
    see all

Images

  • Anti-DHRS12 antibody - C-terminal (ab177968) at 1 µg/ml + Human fetal liver lysate at 10 µg

    Predicted band size: 35 kDa

References

ab177968 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177968.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up