Overview

  • Product name

  • Description

    Rabbit polyclonal to DHRS2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DHRS2 aa 98-156.
    Sequence:

    EDREQLVAKALEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVK SPALLLSQL


    Database link: Q13268

  • Positive control

    • RT-4 cell lysate; RT-4 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220483 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 30 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    DHRS2 belongs to the short-chain dehydrogenases/reductases (SDR) family. It may inhibit cell replication either by catalyzing the oxidation of estrogen and androgen or by converting cortisone in cortisol.
  • Cellular localization

    Mitochondrion matrix. Nucleus. Note: A minor fraction of the protein is translocated from the mitochondria to the nucleus, after cleavage of the targeting signal.
  • Database links

  • Alternative names

    • 5430405K24Rik antibody
    • Dehydrogenase/reductase (SDR family) member 2 antibody
    • Dehydrogenase/reductase member 2 antibody
    • Dehydrogenase/reductase SDR family member 2 antibody
    • Dehydrogenase/reductase SDR family member 2 mitochondria antibody
    • Dicarbonyl reductase HEP27 antibody
    • Hep27 antibody
    • HEP27 protein antibody
    • MGC143467 antibody
    • Protein D antibody
    • SDR family member antibody
    • SDR25C1 antibody
    • Short chain alcohol dehydrogenase family member antibody
    • Short chain dehydrogenase/reductase family 25C member 1 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized RT-4 cells labeling DHRS2 with ab220483 at 4 μg/ml (green).

  • Anti-DHRS2 antibody (ab220483) at 1/250 dilution + RT-4 cell lysate

    Predicted band size: 30 kDa

References

ab220483 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220483.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up