Overview

  • Product name

  • Description

    Rabbit polyclonal to DHRS3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human DHRS3 aa 30-169.
    Sequence:

    PAKLRDLSRENVLITGGGRGIGRQLAREFAERGARKIVLWGRTEKCLKET TEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITILVNNAAVVHG KSLMDSDDDALLKSQHINTLGQFWTTKAFLPRMLELQNGH


    Database link: O75911

  • Positive control

    • WB: Mouse kidney lysate. IHC-P: Human thyroid, placenta, liver and adrenal gland tissue. ICC/IF: A-375 and A549 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236603 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 34 kDa.
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Catalyzes the reduction of all-trans-retinal to all-trans-retinol in the presence of NADPH.
  • Tissue specificity

    Widely expressed with highest levels found in heart, placenta, lung, liver, kidney, pancreas, thyroid, testis, stomach, trachea and spinal cord. Lower levels found in skeletal muscle, intestine and lymph node. No expression detected in brain. In the retina, expressed in cone but not rod outer segments.
  • Sequence similarities

    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • DD83.1 antibody
    • Dehydrogenase/reductase (SDR family) member 3 antibody
    • DHRS3 antibody
    • DHRS3_HUMAN antibody
    • EC 1.1.1.300 antibody
    • MGC125166 antibody
    • RDH17 antibody
    • Retinal short chain dehydrogenase/reductase 1 antibody
    • Retinal short-chain dehydrogenase/reductase 1 antibody
    • retSDR1 antibody
    • Rsdr1 antibody
    • SDR family, member 3 antibody
    • SDR1 antibody
    • SDR16C1 antibody
    • Short-chain dehydrogenase/reductase 3 antibody
    • Short-chain dehydrogenase/reductase family, member 3 antibody
    see all

Images

  • Paraffin-embedded human thyroid tissue stained for DHRS3 using ab236603 at 1/100 dilution in immunohistochemical analysis.

  • A549 (human lung carcinoma cell line) cells stained for DHRS3 (green) using ab236603 at 1/100 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human placenta tissue stained for DHRS3 using ab236603 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver tissue stained for DHRS3 using ab236603 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human adrenal gland tissue stained for DHRS3 using ab236603 at 1/100 dilution in immunohistochemical analysis.

  • A-375 (human malignant melanoma cell line) cells stained for DHRS3 (green) using ab236603 at 1/100 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236603 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236603.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up