Overview

  • Product name

  • Description

    Rabbit polyclonal to DHRS7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human DHRS7 aa 29-339.
    Sequence:

    DGDLTLLWAEWQGRRPEWELTDMVVWVTGASSGIGEELAYQLSKLGVSLV LSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQE FGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMI ERKQGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYPGII VSNICPGPVQSNIVENSLAGEVTKTIGNNGDQSHKMTTSRCVRLMLISMA NDLKEVWISEQPFLLVTYLWQYMPTWAWWITNKMGKKRIENFKSGVDADS SYFKIFKTKHD


    Database link: Q9Y394

  • Positive control

    • WB: HepG2 and MCF7 cell lysate. IHC-P: Human adrenal gland and rectum tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235361 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000.
IHC-P 1/20 - 1/200.

Target

  • Sequence similarities

    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Information by UniProt
  • Database links

  • Alternative names

    • CGI 86 antibody
    • CGI-86 antibody
    • CGI86 antibody
    • Dehydrogenase/reductase (SDR family) member 7 antibody
    • Dehydrogenase/reductase SDR family member 7 antibody
    • Dhrs7 antibody
    • DHRS7_HUMAN antibody
    • DHRS7A antibody
    • retDSR4 antibody
    • Retinal short chain dehydrogenase/reductase 4 antibody
    • Retinal short-chain dehydrogenase/reductase 4 antibody
    • retSDR4 antibody
    • SDR34C1 antibody
    • Short chain dehydrogenase/reductase family 34C, member 1 antibody
    see all

Images

  • All lanes : Anti-DHRS7 antibody (ab235361) at 1/1000 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
    Lane 2 : MCF7 (human breast adenocarcinoma cell line) cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human adrenal gland tissue stained for DHRS7 using ab235361 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human rectum tissue stained for DHRS7 using ab235361 at 1/100 dilution in immunohistochemical analysis.

References

ab235361 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235361.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up