Overview

  • Product name

  • Description

    Rabbit polyclonal to DHTKD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human DHTKD1 aa 16-105.
    Sequence:

    ALPLFWRGYQTERGVYGYRPRKPESREPQGALERPPVDHGLARLVTVYCE HGHKAAKINPLFTGQALLENVPEIQALVQTLQGPFHTAGL


    Database link: Q96HY7

  • Positive control

    • Human kidney tissue; RT-4 cell extracts; MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220098 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 103 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). It contains multiple copies of three enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3).
  • Sequence similarities

    Belongs to the alpha-ketoglutarate dehydrogenase family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • AMOXAD antibody
    • CMT2Q antibody
    • Dehydrogenase E1 and transketolase domain containing 1 antibody
    • Dehydrogenase E1 and transketolase domain containing protein 1 antibody
    • Dehydrogenase E1 and transketolase domain-containing protein 1 antibody
    • DHTK1_HUMAN antibody
    • dhtkd1 antibody
    • DKFZp762M115 antibody
    • KIAA1630 antibody
    • MGC3090 antibody
    • Probable 2 oxoglutarate dehydrogenase E1 component DHKTD1 mitochondrial antibody
    • Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial antibody
    see all

Images

  • Anti-DHTKD1 antibody (ab220098) at 1/100 dilution + RT-4 cell extract

    Predicted band size: 103 kDa

  • Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling DHTKD1 with ab220098 at 1/50 dilution.

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized MCF7 cells labeling DHTKD1 with ab220098 at 4 µg/ml (green).

References

ab220098 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220098.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up