Overview

  • Product name

  • Description

    Rabbit polyclonal to DHTKD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human DHTKD1 aa 1-280.
    Sequence:

    MASATAAAARRGLGRALPLFWRGYQTERGVYGYRPRKPESREPQGALERP PVDHGLARLVTVYCEHGHKAAKINPLFTGQALLENVPEIQALVQTLQGPF HTAGLLNMGKEEASLEEVLVYLNQIYCGQISIETSQLQSQDEKDWFAKRF EELQKETFTTEERKHLSKLMLESQEFDHFLATKFSTVKRYGGEGAESMMG FFHELLKMSAYSGITDVIIGMPHRGRLNLLTGLLQFPPELMFRKMRGLSE FPENFSATGDVLSHLTSSVDLYFGAHHPLH


    Database link: Q96HY7

  • Positive control

    • WB: Mouse liver and kidney lysates; A431, MCF7 and HepG2 whole cell lysates. IHC-P: Human gastric cancer and brain tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab230476 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 103 kDa (predicted molecular weight: 103 kDa).
IHC-P 1/20 - 1/200.

Target

  • Function

    The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). It contains multiple copies of three enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3).
  • Sequence similarities

    Belongs to the alpha-ketoglutarate dehydrogenase family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • AMOXAD antibody
    • CMT2Q antibody
    • Dehydrogenase E1 and transketolase domain containing 1 antibody
    • Dehydrogenase E1 and transketolase domain containing protein 1 antibody
    • Dehydrogenase E1 and transketolase domain-containing protein 1 antibody
    • DHTK1_HUMAN antibody
    • dhtkd1 antibody
    • DKFZp762M115 antibody
    • KIAA1630 antibody
    • MGC3090 antibody
    • Probable 2 oxoglutarate dehydrogenase E1 component DHKTD1 mitochondrial antibody
    • Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial antibody
    see all

Images

  • All lanes : Anti-DHTKD1 antibody (ab230476) at 1/1000 dilution

    Lane 1 : Mouse liver lysate
    Lane 2 : Mouse kidney lysate
    Lane 3 : A431 (human epidermoid carcinoma cell line) whole cell lysate
    Lane 4 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 5 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 103 kDa
    Observed band size: 103 kDa

  • Paraffin-embedded human gastric cancer tissue stained for DHTKD1 using ab230476 at 1/100 dilution in immunohistochemical analysis.

          

  • Paraffin-embedded human brain tissue stained for DHTKD1 using ab230476 at 1/100 dilution in immunohistochemical analysis.

References

ab230476 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230476.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up