Overview

  • Product name

  • Description

    Rabbit polyclonal to DHX35
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human DHX35 aa 606-701.
    Sequence:

    VLRCIVSGFFANAARFHSTGAYRTIRDDHELHIHPASVLYAEKPPRWVIY NEVIQTSKYYMRDVTAIESAWLLELAPHFYQQGTHLSLKAKRAKVQ


    Database link: Q9H5Z1

  • Positive control

    • ICC/IF: RH-30 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222244 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fization/Permeabilization: PFA/Triton X-100

Target

  • Relevance

    DEAD box proteins characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The function of DHX35 which is a member of this family, has not been determined.DEAD box proteins characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The function of this gene product which is a member of this family, has not been determined.
  • Cellular localization

    Spliceosomal complex
  • Database links

  • Alternative names

    • C20orf15 antibody
    • DDX35 antibody
    • DEAH (Asp-Glu-Ala-His) box polypeptide 35 antibody
    • DEAH box protein 35 antibody
    • KAIA0875 antibody
    see all

Images

  • 4% paraformaldehyde-fixed, 0.1% Triton X-100 permeabilized RH-30 cells stained for DHX35 (green) using ab222244 at 4 µg/ml in ICC/IF.

References

ab222244 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222244.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up