Overview

  • Product name

    Anti-DIAPH1 antibody - C-terminal
    See all DIAPH1 primary antibodies
  • Description

    Rabbit polyclonal to DIAPH1 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human DIAPH1 aa 1158-1272 (C terminal).
    Sequence:

    TEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQ SGAAFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVPAKVSKNSETF PTILEEAKELVGRAS


    Database link: O60610

  • Positive control

    • HL60, MCF7, 293T, HepG2, mouse liver and mouse lung extracts.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab189840 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 141 kDa.
IHC-P 1/50 - 1/200.

Target

  • Function

    Acts in a Rho-dependent manner to recruit PFY1 to the membrane. Required for the assembly of F-actin structures, such as actin cables and stress fibers. Nucleates actin filaments. Binds to the barbed end of the actin filament and slows down actin polymerization and depolymerization. Required for cytokinesis, and transcriptional activation of the serum response factor. DFR proteins couple Rho and Src tyrosine kinase during signaling and the regulation of actin dynamics. Functions as a scaffold protein for MAPRE1 and APC to stabilize microtubules and promote cell migration (By similarity). Has neurite outgrowth promoting activity (By similarity). In hear cells, it may play a role in the regulation of actin polymerization in hair cells. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization.
  • Tissue specificity

    Expressed in brain, heart, placenta, lung, kidney, pancreas, liver, skeletal muscle and cochlea.
  • Involvement in disease

    Defects in DIAPH1 are the cause of deafness autosomal dominant type 1 (DFNA1) [MIM:124900]. DFNA1 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information.
  • Sequence similarities

    Belongs to the formin homology family. Diaphanous subfamily.
    Contains 1 DAD (diaphanous autoregulatory) domain.
    Contains 1 FH1 (formin homology 1) domain.
    Contains 1 FH2 (formin homology 2) domain.
    Contains 1 GBD/FH3 (Rho GTPase-binding/formin homology 3) domain.
  • Domain

    DRFs are regulated by intramolecular GBD-DAD binding where Rho-GTP activates the DRFs by disrupting the GBD-DAD interaction (By similarity). DCAF7 binds to the FH2 (formin homology 2) domain.
  • Cellular localization

    Cell membrane. Cell projection > ruffle membrane. Cytoplasm > cytoskeleton. Membrane ruffles, especially at the tip of ruffles, of motile cells.
  • Information by UniProt
  • Database links

  • Alternative names

    • DIAPH1 antibody
    • deafness, autosomal dominant 1 antibody
    • DFNA1 antibody
    • DIA1 antibody
    • DIAP1 antibody
    • DIAP1_HUMAN antibody
    • DIAPH1 antibody
    • Diaphanous homolog 1 (Drosophila) antibody
    • diaphanous homolog 1 antibody
    • Diaphanous related formin 1 antibody
    • Diaphanous-related formin-1 antibody
    • DRF1 antibody
    • FLJ25265 antibody
    • hDIA1 antibody
    • LFHL1 antibody
    • low frequency hearing loss 1 antibody
    • p140DIA antibody
    • Protein diaphanous homolog 1 antibody
    see all

Images

  • All lanes : Anti-DIAPH1 antibody - C-terminal (ab189840) at 1/500 dilution

    Lane 1 : HL60 cell extract
    Lane 2 : MCF7 cell extract
    Lane 3 : 293T cell extract
    Lane 4 : HepG2 cell extract
    Lane 5 : Mouse liver extract
    Lane 6 : Mouse lung extract

    Predicted band size: 141 kDa

References

ab189840 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189840.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up