For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    diaph2dia-antibody-ab201205.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Cytoskeleton / ECM Cytoskeleton Microfilaments Actin etc Actin Binding Proteins
Share by email

Anti-DIAPH2/DIA antibody (ab201205)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DIAPH2/DIA antibody (ab201205)
  • Western blot - Anti-DIAPH2/DIA antibody (ab201205)

Key features and details

  • Rabbit polyclonal to DIAPH2/DIA
  • Suitable for: WB, IHC-P
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

View more associated products

Overview

  • Product name

    Anti-DIAPH2/DIA antibody
    See all DIAPH2/DIA primary antibodies
  • Description

    Rabbit polyclonal to DIAPH2/DIA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human DIAPH2/DIA aa 794-997.
    Sequence:

    KMLQPRLSSILFKLTFEEHINNIKPSIIAVTLACEELKKSESFNRLLELV LLVGNYMNSGSRNAQSLGFKINFLCKIRDTKSADQKTTLLHFIADICEEK YRDILKFPEELEHVESASKVSAQILKSNLASMEQQIVHLERDIKKFPQAE NQHDKFVEKMTSFTKTAREQYEKLSTMHNNMMKLYENLGEYFIFDSKTVS IEE


    Database link: BC117414
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Mouse brain tissue lysate; Human fetal testis tissue.
  • General notes

     This product was previously labelled as DIAPH2

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Lyophilized:Reconstitute in 200ul Sterile Distilled Water.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Cytoskeleton / ECM
    • Cytoskeleton
    • Microfilaments
    • Actin etc
    • Actin Binding Proteins
    • Signal Transduction
    • Protein Trafficking
    • Vesicle Transport
    • Regulation

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Positive Controls

    • Mouse brain tissue lysate - total protein (ab30151)

Applications

Our Abpromise guarantee covers the use of ab201205 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 126 kDa.
IHC-P 1/100 - 1/500.

Target

  • Function

    Could be involved in oogenesis. Involved in the regulation of endosome dynamics. Implicated in a novel signal transduction pathway, in which isoform 3 and CSK are sequentially activated by RHOD to regulate the motility of early endosomes through interactions with the actin cytoskeleton.
  • Tissue specificity

    Expressed in testis, ovary, small intestine, prostate, lung, liver, kidney and leukocytes.
  • Involvement in disease

    Defects in DIAPH2 are the cause of premature ovarian failure type 2A (POF2A) [MIM:300511]. An ovarian disorder defined as the cessation of ovarian function under the age of 40 years. It is characterized by oligomenorrhea or amenorrhea, in the presence of elevated levels of serum gonadotropins and low estradiol.
  • Sequence similarities

    Belongs to the formin homology family. Diaphanous subfamily.
    Contains 1 DAD (diaphanous autoregulatory) domain.
    Contains 1 FH1 (formin homology 1) domain.
    Contains 1 FH2 (formin homology 2) domain.
    Contains 1 GBD/FH3 (Rho GTPase-binding/formin homology 3) domain.
  • Developmental stage

    Expressed from E16 in ovary and testis and during P6-P16 during differentiation of ovarian follicles.
  • Domain

    DRFs are regulated by intramolecular GBD-DAD binding where Rho-GTP activates the DRFs by disrupting the GBD-DAD interaction.
  • Cellular localization

    Cytoplasm > cytosol. Early endosome. Isoform 3 is cytosolic but when coexpressed with RHOD, the 2 proteins colocalize to early endosomes.
  • Target information above from: UniProt accession O60879 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 1730 Human
    • Entrez Gene: 54004 Mouse
    • Omim: 300108 Human
    • SwissProt: O60879 Human
    • SwissProt: O70566 Mouse
    • Unigene: 226483 Human
    • Unigene: 10763 Mouse
    • Alternative names

      • Dia 2 antibody
      • DIA antibody
      • Dia drome antibody
      • Dia2 antibody
      • Diap 2 antibody
      • Diap2 antibody
      • DIAP2_HUMAN antibody
      • DIAPH 2 antibody
      • Diaph2 antibody
      • Diaphanous 2 antibody
      • Diaphanous homolog 2 (Drosophila) antibody
      • Diaphanous homolog 2 antibody
      • Diaphanous related formin 2 antibody
      • Diaphanous-related formin-2 antibody
      • Diaphanous2 antibody
      • Diaphorase 2 antibody
      • Diaphorase2 antibody
      • DRF 2 antibody
      • DRF2 antibody
      • FLJ11167 antibody
      • OTTHUMP00000024270 antibody
      • OTTHUMP00000024271 antibody
      • OTTHUMP00000062171 antibody
      • POF 2 antibody
      • POF antibody
      • POF2 antibody
      • Protein diaphanous homolog 2 antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DIAPH2/DIA antibody (ab201205)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DIAPH2/DIA antibody (ab201205)

      Immunohistochemical analysis of Formalin-fixed, Paraffin-embedded Human fetal testis tissue labeling DIAPH2/DIA with ab201205 at 1/100 dilution.

    • Western blot - Anti-DIAPH2/DIA antibody (ab201205)
      Western blot - Anti-DIAPH2/DIA antibody (ab201205)
      Anti-DIAPH2/DIA antibody (ab201205) at 1/500 dilution + Mouse brain tissue lysate

      Predicted band size: 126 kDa

    Protocols

    • Western blot protocols
    • Immunohistochemistry protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
    • SDS
  • References (0)

    Publishing research using ab201205? Please let us know so that we can cite the reference in this datasheet.

    ab201205 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab201205.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.