Anti-DIAPH2/DIA antibody (ab201205)
Key features and details
- Rabbit polyclonal to DIAPH2/DIA
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-DIAPH2/DIA antibody
See all DIAPH2/DIA primary antibodies -
Description
Rabbit polyclonal to DIAPH2/DIA -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse -
Immunogen
Recombinant fragment corresponding to Human DIAPH2/DIA aa 794-997.
Sequence:KMLQPRLSSILFKLTFEEHINNIKPSIIAVTLACEELKKSESFNRLLELV LLVGNYMNSGSRNAQSLGFKINFLCKIRDTKSADQKTTLLHFIADICEEK YRDILKFPEELEHVESASKVSAQILKSNLASMEQQIVHLERDIKKFPQAE NQHDKFVEKMTSFTKTAREQYEKLSTMHNNMMKLYENLGEYFIFDSKTVS IEE
Database link: BC117414 -
Positive control
- Mouse brain tissue lysate; Human fetal testis tissue.
-
General notes
This product was previously labelled as DIAPH2
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Lyophilized:Reconstitute in 200ul Sterile Distilled Water. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 98% PBS, 1% BSA -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab201205 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/200 - 1/1000. Predicted molecular weight: 126 kDa. | |
IHC-P | 1/100 - 1/500. |
Target
-
Function
Could be involved in oogenesis. Involved in the regulation of endosome dynamics. Implicated in a novel signal transduction pathway, in which isoform 3 and CSK are sequentially activated by RHOD to regulate the motility of early endosomes through interactions with the actin cytoskeleton. -
Tissue specificity
Expressed in testis, ovary, small intestine, prostate, lung, liver, kidney and leukocytes. -
Involvement in disease
Defects in DIAPH2 are the cause of premature ovarian failure type 2A (POF2A) [MIM:300511]. An ovarian disorder defined as the cessation of ovarian function under the age of 40 years. It is characterized by oligomenorrhea or amenorrhea, in the presence of elevated levels of serum gonadotropins and low estradiol. -
Sequence similarities
Belongs to the formin homology family. Diaphanous subfamily.
Contains 1 DAD (diaphanous autoregulatory) domain.
Contains 1 FH1 (formin homology 1) domain.
Contains 1 FH2 (formin homology 2) domain.
Contains 1 GBD/FH3 (Rho GTPase-binding/formin homology 3) domain. -
Developmental stage
Expressed from E16 in ovary and testis and during P6-P16 during differentiation of ovarian follicles. -
Domain
DRFs are regulated by intramolecular GBD-DAD binding where Rho-GTP activates the DRFs by disrupting the GBD-DAD interaction. -
Cellular localization
Cytoplasm > cytosol. Early endosome. Isoform 3 is cytosolic but when coexpressed with RHOD, the 2 proteins colocalize to early endosomes. - Information by UniProt
-
Database links
- Entrez Gene: 1730 Human
- Entrez Gene: 54004 Mouse
- Omim: 300108 Human
- SwissProt: O60879 Human
- SwissProt: O70566 Mouse
- Unigene: 226483 Human
- Unigene: 10763 Mouse
-
Alternative names
- Dia 2 antibody
- DIA antibody
- Dia drome antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DIAPH2/DIA antibody (ab201205)
Immunohistochemical analysis of Formalin-fixed, Paraffin-embedded Human fetal testis tissue labeling DIAPH2/DIA with ab201205 at 1/100 dilution.
-
Anti-DIAPH2/DIA antibody (ab201205) at 1/500 dilution + Mouse brain tissue lysate
Predicted band size: 126 kDa
Protocols
References (0)
ab201205 has not yet been referenced specifically in any publications.