Overview

  • Product name
  • Description
    Mouse Polyclonal to DIAPH3
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human DIAPH3 aa 1-849.
    Sequence:

    MSEERSLSLLAKAVDPRHPNMMTDVVKLLSAVCIVGEESILEEVLEALTS AGEEKKIDRFFCIVEGLRHNSVQLQVACMQLINALVTSPDDLDFRLHIRN EFMRCGLKEILPNLKCIKNDGLDIQLKVFDEHKEEDLFELSHRLEDIRAE LDEAYDVYNMVWSTVKETRAEGYFISILQHLLLIRNDYFIRQQYFKLIDE CVSQIVLHRDGMDPDFTYRKRLDLDLTQFVDICIDQAKLEEFEEKASELY KKFEKEFTDHQETQAELQKKEAKINELQAELQAFKSQFGALPADCNIPLP PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLPGMRMPFSGPVPPP PPLGFLGGQNSPPLPILPFGLKPKKEFKPEISMRRLNWLKIRPHEMTENC FWIKVNENKYENVDLLCKLENTFCCQQKERREEEDIEEKKSIKKKIKELK FLDSKIAQNLSIFLSSFRVPYEEIRMMILEVDETRLAESMIQNLIKHLPD QEQLNSLSQFKSEYSNLCEPEQFVVVMSNVKRLRPRLSAILFKLQFEEQV NNIKPDIMAVSTACEEIKKSKSFSKLLELVLLMGNYMNAGSRNAQTFGFN LSSLCKLKDTKSADQKTTLLHFLVEICEEKYPDILNFVDDLEPLDKASKV SVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRFVISAKEQ YETLSKLHENMEKLYQSIIGYYAIDVKKVSVEDFLTDLNNFRTTFMQAIK ENIKKREAEEKEKRVRIAKELAERERLERQQKKKRLLEMKTEGDETGVMD NLLEALQSGAAFRDRRKRTPMPKDVRQSLSPMSQRPVLKVCNHGNKPYL


    Database link: NP_112194.2

  • Positive control
    • DIAPH3 transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab172701 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 98 kDa.

Target

  • Function
    Binds to GTP-bound form of Rho and to profilin. Acts in a Rho-dependent manner to recruit profilin to the membrane, where it promotes actin polymerization. It is required for cytokinesis, stress fiber formation, and transcriptional activation of the serum response factor. DFR proteins couple Rho and Src tyrosine kinase during signaling and the regulation of actin dynamics.
  • Sequence similarities
    Belongs to the formin homology family. Diaphanous subfamily.
    Contains 1 DAD (diaphanous autoregulatory) domain.
    Contains 1 FH1 (formin homology 1) domain.
    Contains 1 FH2 (formin homology 2) domain.
    Contains 1 GBD/FH3 (Rho GTPase-binding/formin homology 3) domain.
  • Domain
    DRFs are regulated by intramolecular GBD-DAD binding where Rho-GTP activates the DRFs by disrupting the GBD-DAD interaction.
  • Information by UniProt
  • Database links
  • Alternative names
    • AN antibody
    • AUNA1 antibody
    • Dia2 antibody
    • diap3 antibody
    • DIAP3_HUMAN antibody
    • DIAPH3 antibody
    • Diaphanous homolog 3 (Drosophila) antibody
    • Diaphanous homolog 3 antibody
    • Diaphanous related formin 3 antibody
    • Diaphanous, Drosophila, homolog of, 3 antibody
    • Diaphanous-related formin-3 antibody
    • DKFZp434C0931 antibody
    • DKFZp686A13178 antibody
    • DRF3 antibody
    • FLJ34705 antibody
    • mDia2 antibody
    • NSDAN antibody
    • OTTHUMP00000018480 antibody
    • Protein diaphanous homolog 3 antibody
    • RP11-26P21.1 antibody
    see all

Images

  • All lanes : Anti-DIAPH3 antibody (ab172701) at 1 µg/ml

    Lane 1 : DIAPH3 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-mouse HRP Conjugate at 1/2500 dilution

    Predicted band size: 98 kDa

References

ab172701 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172701.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up