Overview

  • Product name

  • Description

    Rabbit polyclonal to Dicer
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Zebrafish, Chinese hamster, Xenopus tropicalis
  • Immunogen

    Recombinant fragment corresponding to Human Dicer aa 869-1062.
    Sequence:

    PTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKET PFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETF AEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAE KRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLH


    Database link: Q9UPY3

  • Positive control

    • IHC-P: Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab223686 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Double-stranded RNA (dsRNA) endoribonuclease playing a central role in short dsRNA-mediated post-transcriptional gene silencing. Cleaves naturally occurring long dsRNAs and short hairpin pre-microRNAs (miRNA) into fragments of twenty-one to twenty-three nucleotides with 3' overhang of two nucleotides, producing respectively short interfering RNAs (siRNA) and mature microRNAs. SiRNAs and miRNAs serve as guide to direct the RNA-induced silencing complex (RISC) to complementary RNAs to degrade them or prevent their translation. Gene silencing mediated by siRNAs, also called RNA interference, controls the elimination of transcripts from mobile and repetitive DNA elements of the genome but also the degradation of exogenous RNA of viral origin for instance. The miRNA pathway on the other side is a mean to specifically regulate the expression of target genes.
  • Involvement in disease

    Pleuropulmonary blastoma
    Goiter multinodular 1, with or without Sertoli-Leydig cell tumors
    Rhabdomyosarcoma, embryonal, 2
    DICER1 mutations have been found in uterine cervix embryonal rhabdomyosarcoma, primitive neuroectodermal tumor, Wilms tumor, pulmonary sequestration and juvenile intestinal polyp (PubMed:21882293). Somatic missense mutations affecting the RNase IIIb domain of DICER1 are common in non-epithelial ovarian tumors. These mutations do not abolish DICER1 function but alter it in specific cell types, a novel mechanism through which perturbation of microRNA processing may be oncogenic (PubMed:22187960).
  • Sequence similarities

    Belongs to the helicase family. Dicer subfamily.
    Contains 1 Dicer dsRNA-binding fold domain.
    Contains 1 DRBM (double-stranded RNA-binding) domain.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
    Contains 1 PAZ domain.
    Contains 2 RNase III domains.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • DCR antibody
    • DCR1 antibody
    • Dicer 1 ribonuclease III antibody
    • Dicer 1 ribonuclease type III antibody
    • Dicer antibody
    • DICER_HUMAN antibody
    • DICER1 antibody
    • Double-strand-specific ribonuclease antibody
    • Endoribonuclease Dicer antibody
    • Helicase MOI antibody
    • Helicase with RNase motif antibody
    • HERNA antibody
    • KIAA0928 antibody
    • MNG1 antibody
    • RMSE2 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for Dicer using ab223686 at 1/200 dilution in immunohistochemical analysis.

References

ab223686 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223686.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up