Anti-Diffuse panbronchiolitis critical region protein 1 antibody (ab224369)

Overview

  • Product name

    Anti-Diffuse panbronchiolitis critical region protein 1 antibody
    See all Diffuse panbronchiolitis critical region protein 1 primary antibodies
  • Description

    Rabbit polyclonal to Diffuse panbronchiolitis critical region protein 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Diffuse panbronchiolitis critical region protein 1 aa 14-149.
    Sequence:

    KTTSTTEKTTRTPEKPTLYSEKTICTKGKNTPVPEKPTENLGNTTLTTET IKAPVKSTENPEKTAAVTKTIKPSVKVTGDKSLTTTSSHLNKTEVTHQVP TGSFTLITSRTKLSSITSEATGNESHPYLNKDGSQK


    Database link: Q3MIW9-2

  • Positive control

    • IHC-P: Human stomach tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224369 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Tissue specificity

    Detected in lung, esophagus, stomach, rectum, skin, cervix, testis, kidney, uterus and small intestine.
  • Developmental stage

    Expressed in fetal heart, kidney and lung.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • bCX105N19.6 antibody
    • Diffuse panbronchiolitis critical region 1 antibody
    • Diffuse panbronchiolitis critical region antibody
    • Diffuse panbronchiolitis critical region protein 1 antibody
    • DKFZp666O235 antibody
    • DPCR protein antibody
    • DPCR1 antibody
    • DPCR1_HUMAN antibody
    • MGC126710 antibody
    • MGC126712 antibody
    • OTTHUMP00000062447 antibody
    • PBLT antibody
    see all

Images

  • Paraffin-embedded human stomach tissue stained for Diffuse panbronchiolitis critical region protein 1 using ab224369 at 1/20 dilution in immunohistochemical analysis.

References

ab224369 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224369.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up