Overview

  • Product name

  • Description

    Rabbit polyclonal to Dio3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Rat Dio3 aa 37-169. N-terminal His-tag and MBP-tag; expressed in E.coli.
    Sequence:

    RLCAQTASCLVLFPRFLGTAFMLWLLDFLCIRKHFLRRRHPDHPEPEVEL NSEGEEMPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAP NSEVVRPDGFQSQRILDYAQGTRPLVLNFGSCT


    Database link: P49897

  • Positive control

    • WB: Rat blood cell, placenta, uterus and liver lysate; Recombinant rat Dio3 protein. IHC-P: Rat skeletal muscle tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233035 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 34 kDa.

Target

  • Function

    Responsible for the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into RT3 (3,3',5'-triiodothyronine) and of T3 (3,5,3'-triiodothyronine) into T2 (3,3'-diiodothyronine). RT3 and T2 are inactive metabolites. May play a role in preventing premature exposure of developing fetal tissues to adult levels of thyroid hormones. Can regulate circulating fetal thyroid hormone concentrations throughout gestation. Essential role for regulation of thyroid hormone inactivation during embryological development.
  • Tissue specificity

    Expressed in placenta and several fetal tissues.
  • Sequence similarities

    Belongs to the iodothyronine deiodinase family.
  • Cellular localization

    Cell membrane. Endosome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5DIII antibody
    • D3 antibody
    • Deiodinase iodothyronine type 3 antibody
    • Deiodinase iodothyronine type III antibody
    • Dio 3 antibody
    • Dio3 antibody
    • DIOIII antibody
    • IOD3_HUMAN antibody
    • Iodothyronine deiodinase placental type antibody
    • MGC124117 antibody
    • MGC124118 antibody
    • Thyroxine deiodinase type III antibody
    • Thyroxine deiodinase type III (selenoprotein) antibody
    • TXDI3 antibody
    • Type 3 DI antibody
    • Type 3 iodothyronine selenodeiodinase antibody
    • Type III 5' deiodinase antibody
    • Type III iodothyronine deiodinase antibody
    • Type-III 5''-deiodinase antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat skeletal muscle tissue stained for Dio3 using ab233035 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-Dio3 antibody (ab233035) at 1 µg/ml + Rat liver lysate

    Predicted band size: 34 kDa

  • Anti-Dio3 antibody (ab233035) at 1 µg/ml + Rat uterus lysate

    Predicted band size: 34 kDa

  • Anti-Dio3 antibody (ab233035) at 1 µg/ml + Rat placenta lysate

    Predicted band size: 34 kDa

  • Anti-Dio3 antibody (ab233035) at 1 µg/ml + Rat blood cell lysate

    Predicted band size: 34 kDa

  • Anti-Dio3 antibody (ab233035) at 1 µg/ml + Recombinant rat Dio3 protein

    Predicted band size: 34 kDa

References

ab233035 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233035.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up