Overview

  • Product name

  • Description

    Rabbit polyclonal to Dio3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Cow
  • Immunogen

    Recombinant fragment corresponding to Human Dio3 aa 50-115.
    Sequence:

    PRFLGTAFMLWLLDFLCIRKHFLGRRRRGQPEPEVELNSEGEEVPPDDPP ICVSDDNRLCTLASLK


    Database link: P55073

  • Positive control

    • ICC/IF: PC-3 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab234770 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.

Target

  • Function

    Responsible for the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into RT3 (3,3',5'-triiodothyronine) and of T3 (3,5,3'-triiodothyronine) into T2 (3,3'-diiodothyronine). RT3 and T2 are inactive metabolites. May play a role in preventing premature exposure of developing fetal tissues to adult levels of thyroid hormones. Can regulate circulating fetal thyroid hormone concentrations throughout gestation. Essential role for regulation of thyroid hormone inactivation during embryological development.
  • Tissue specificity

    Expressed in placenta and several fetal tissues.
  • Sequence similarities

    Belongs to the iodothyronine deiodinase family.
  • Cellular localization

    Cell membrane. Endosome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5DIII antibody
    • D3 antibody
    • Deiodinase iodothyronine type 3 antibody
    • Deiodinase iodothyronine type III antibody
    • Dio 3 antibody
    • Dio3 antibody
    • DIOIII antibody
    • IOD3_HUMAN antibody
    • Iodothyronine deiodinase placental type antibody
    • MGC124117 antibody
    • MGC124118 antibody
    • Thyroxine deiodinase type III antibody
    • Thyroxine deiodinase type III (selenoprotein) antibody
    • TXDI3 antibody
    • Type 3 DI antibody
    • Type 3 iodothyronine selenodeiodinase antibody
    • Type III 5' deiodinase antibody
    • Type III iodothyronine deiodinase antibody
    • Type-III 5''-deiodinase antibody
    see all

Images

  • PC-3 (Human prostate adenocarcinoma cell line) cells stained for Dio3 (green) using ab234770 at 1/100 dilution in ICC/IF, followed by an Alexa-Fluor® 488 conjugated Goat Anti-Rabbit IgG (H+L).

References

ab234770 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234770.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up