Overview

  • Product name

  • Description

    Rabbit polyclonal to DIRAS1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human DIRAS1 aa 1-195. Full length mature chain without propeptide.
    Sequence:

    MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISC DKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPI YKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETS AKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKC


    Database link: O95057

  • Positive control

    • IHC-P: Human brain tissue. ICC/IF: A549 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab238491 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500.
ICC/IF 1/50 - 1/200.

Target

  • Relevance

    The three human RAS genes encode highly related 188 to 189 amino acid proteins, designated H-Ras, N-Ras and K-Ras4A and K-Ras4B (the two K-Ras proteins arise from alternative gene splicing). Ras proteins function as binary molecular switches that control intracellular signaling networks. Ras-regulated signal pathways control such processes as actin cytoskeletal integrity, proliferation, differentiation, cell adhesion, apoptosis, and cell migration. Ras and ras-related proteins are often deregulated in cancers, leading to increased invasion and metastasis, and decreased apoptosis. DIRAS1 displays low GTPase activity and exists predominantly in the GTP-bound form. It is highly expressed in heart and brain.
  • Cellular localization

    Cell membrane; Lipid-anchor; Cytoplasmic side
  • Database links

  • Alternative names

    • Di Ras1 antibody
    • DIRAS family GTP binding RAS like 1 antibody
    • Distinct subgroup of the Ras family member 1 antibody
    • FLJ42681 antibody
    • GBTS1 antibody
    • GTP binding protein Di Ras1 antibody
    • Ras related inhibitor of cell growth antibody
    • RIG antibody
    • Rig protein antibody
    • Small GTP binding tumor suppressor 1 antibody
    see all

Images

  • Paraffin-embedded human brain tissue stained for DIRAS1 using ab238491 at 1/200 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at room temperature. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • A549 (Human lung carcinoma cell line) cells stained for DIRAS1 (green) using ab238491 at 1/66 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the antibody overnight at 4°C.

References

ab238491 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238491.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up