Overview

  • Product name

  • Description

    Rabbit polyclonal to DIS3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human DIS3 aa 908-958. The exact sequence is proprietary. (NP_055768.3).
    Sequence:

    KVKIMLDSSNLQHQKIRMSLVEPQIPGISIPTDTSNMDLNGPKKKKMKLG K


    Database link: Q9Y2L1

  • Positive control

    • HeLa, 293T and Jurkat whole cell lysates.
  • General notes

     This product was previously labelled as DIS3, Dis3

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab176802 was affinity purified using an epitope specific to DIS3 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab176802 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/2000 - 1/10000. Predicted molecular weight: 109 kDa.

Target

  • Function

    Putative catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as anti-sense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. DIS3 has both 3'-5' exonuclease and endonuclease activities.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the RNR ribonuclease family.
    Contains 1 PINc domain.
  • Cellular localization

    Cytoplasm. Nucleus > nucleolus. Nucleus > nucleoplasm. Nucleus. Predominantly located in the nucleus. According to PubMed:12429849, found in the nucleolus and according to PubMed:20531386, excluded from nucleolus supporting the existence of a nucleolar RNA exosome complex devoid of DIS3.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2810028N01Rik antibody
    • bA555G22 antibody
    • Dis3 antibody
    • DIS3 homolog, exosome endoribonuclease and 3'-5' exoribonuclease antibody
    • DIS3 mitotic control homolog (S. cerevisiae) antibody
    • DIS3 mitotic control homolog antibody
    • DIS3 mitotic control, S. cerevisiae, homolog of antibody
    • dis3p antibody
    • EXOSC11 antibody
    • Exosome complex exonuclease RRP44 antibody
    • exosome component 11 antibody
    • KIAA1008 antibody
    • Mitotic control protein dis3 homolog antibody
    • Protein DIS3 homolog antibody
    • Ribosomal RNA processing protein 44 antibody
    • Ribosomal RNA processing protein 44, S. cerevisiae, homolog of antibody
    • Ribosomal RNA-processing protein 44 antibody
    • RP11-342J4.3 antibody
    • RRP44 antibody
    • RRP44_HUMAN antibody
    see all

Images

  • All lanes : Anti-DIS3 antibody (ab176802) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : 293T whole cell lysate at 50 µg
    Lane 4 : Jurkat whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 109 kDa


    Exposure time: 30 seconds
  • Detection of DIS3 in immunoprecipitates of HeLa whole cell lysate (1 mg for IP, 20% of IP loaded) using ab176802 at 6 µg/mg lysate for IP (Lane 1) and at 1 µg/ml for subsequent Western blot detection. Lane 2 represents control IgG IP.

    Detection: Chemiluminescence with an exposure time of 10 seconds.

References

ab176802 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176802.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up