Overview

  • Product name

    Anti-DIS3L2 antibody [6C7B2]
    See all DIS3L2 primary antibodies
  • Description

    Mouse monoclonal [6C7B2] to DIS3L2
  • Host species

    Mouse
  • Tested applications

    Suitable for: Flow Cyt, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DIS3L2 aa 27-250. Expressed in E. Coli.
    Sequence:

    DIGASPGDKKSKNRSTRGKKKSIFETYMSKEDVSEGLKRGTLIQGVLRIN PKKFHEAFIPSPDGDRDIFIDGVVARNRALNGDLVVVKLLPEEHWKVVKP ESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQFDGSDSE DGHGITQNVLVDGVKKLSVCVSEKGREDGDAPVTKDETTCISQDTRALSE KSLQRSAKVVYILEKKHSRAATGF


    Database link: Q8IYB7

  • Positive control

    • HeLa and HepG2 cell lysates; DIS3L2 recombinant protein; DIS3L2 (aa 27-250)-hIgGFc transfected HEK293 cell lysate; Jurkat cells; Human endometrial cancer and Human bladder cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS

    0.5% protein stabilizer
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    6C7B2
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab181743 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 99 kDa.

Target

  • Function

    Ribonuclease that plays a critical role in RNA metabolism. It is essential for correct mitosis, and negatively regulates cell proliferation.
  • Involvement in disease

    Defects in DIS3L2 are the cause of Perlman syndrome (PRLMNS) [MIM:267000]. An autosomal recessive congenital overgrowth syndrome. Affected children are large at birth, are hypotonic, and show organomegaly, characteristic facial dysmorphisms (inverted V-shaped upper lip, prominent forehead, deep-set eyes, broad and flat nasal bridge, and low-set ears), renal anomalies (nephromegaly and hydronephrosis), frequent neurodevelopmental delay, and high neonatal mortality. Perlman syndrome is associated with a high risk of Wilms tumor. Histologic examination of the kidneys in affected children shows frequent nephroblastomatosis, which is a precursor lesion for Wilms tumor.
  • Sequence similarities

    Belongs to the RNR ribonuclease family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • DI3L2_HUMAN antibody
    • DIS3 L2 antibody
    • DIS3 mitotic control homolog (S. cerevisiae) like 2 antibody
    • DIS3 mitotic control homolog like 2 antibody
    • DIS3-like exonuclease 2 antibody
    • Dis3l2 antibody
    • FLJ36974 antibody
    • MGC42174 antibody
    see all

Images

  • All lanes : Anti-DIS3L2 antibody [6C7B2] (ab181743) at 1/500 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : HepG2 cell lysate

    Predicted band size: 99 kDa

  • All lanes : Anti-DIS3L2 antibody [6C7B2] (ab181743) at 1/500 dilution

    Lane 1 : non-transfected HEK293 cell lysate
    Lane 2 : DIS3L2 (aa 27-250)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 99 kDa

  • Anti-DIS3L2 antibody [6C7B2] (ab181743) at 1/500 dilution + DIS3L2 recombinant protein

    Predicted band size: 99 kDa

  • Flow Cytometrical analysis of Jurkat cells labeling DIS3L2 with ab181743 at 1/200 (green) compared to a negative control antibody (red).

  • Immunohistochemical analysis of paraffin embedded Human bladder cancer tissue labeling DIS3L2 with ab181743 at 1/200.

  • Immunohistochemical analysis of paraffin embedded Human endometrial cancer tissue labeling DIS3L2 with ab181743 at 1/200.

References

ab181743 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181743.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up