Overview

  • Product name

    Anti-DISP2 antibody
  • Description

    Rabbit polyclonal to DISP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human DISP2 aa 1150-1200 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    GSVGGMPGSCSEQYELQPLARRRSPSFDTSTATSKLSHRPSVLSEDLQLH D


    Database link: A7MBM2

  • Positive control

    • Human lung carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab203066 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 152 kDa.
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200.

Target

  • Relevance

    DISP2 is the second of three known homologs of the D.melanogaster protein Dispatched. It is a multitransmembrane protein containing two PTCH/DISP domains and is thought to be involved in the release of lipid-anchored Hedgehog from producing cells. Hedgehog is a major player in signaling pathways during embryogenesis, tissue regeneration, and carcinogenesis and the DISP proteins have been implicated in these pathways. Recently, it has been shown that DISP2 is translationally regulated by the microRNA miR-214 in zebrafish. Expression of this miRNA decreased DISP2 promoter activity in vitro and its overexpression in zebrafish resulted in a phenotype identical to that observed by DISP2 mutants. At least two isoforms of DISP2 are known to exist.
  • Cellular localization

    Membrane; Multi-pass membrane protein.
  • Database links

  • Alternative names

    • DISP 2 antibody
    • Dispatched B antibody
    • Dispatched homolog 2 (Drosophila) antibody
    • Dispatched homolog 2 antibody
    • DISPB antibody
    • DKFZp547N223 antibody
    • HsT16908 antibody
    • KIAA1742 antibody
    • Protein dispatched homolog 2 antibody
    see all

Images

  • Immunohistochemical analysis of formalin fixed and paraffin embedded human lung carcinoma labeling DIPS2 using ab203066 at 1/200 dilution. DAB staining.

References

ab203066 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203066.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up