Overview

  • Product name
  • Description
    Rabbit polyclonal to DIXDC1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IPmore details
    Unsuitable for: WB
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Rabbit, Horse, Pig, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Chinese hamster, Orangutan
  • Immunogen

    Synthetic peptide within Human DIXDC1 aa 225-275. The exact sequence is proprietary. (NP_001033043.1).
    Sequence:

    PIHSAKSESIITQSEEKADFVIIPAEGIENRTEGTDSPLSRDWRPGSPGT Y


    Database link: Q155Q3

  • Positive control
    • 293T whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab177517 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
  • Application notes
    Is unsuitable for WB.
  • Target

    • Function
      Positive effector of the Wnt signaling pathway; activates WNT3A signaling via DVL2. Regulates JNK activation by AXIN1 and DVL2.
    • Tissue specificity
      Ubiquitously expressed with higher expression in cardiac and skeletal muscles.
    • Sequence similarities
      Belongs to the DIXDC1 family.
      Contains 1 CH (calponin-homology) domain.
      Contains 1 DIX domain.
    • Domain
      The coiled-coil domain mediates interaction with MAP3K4 and inhibition of AXIN1-mediated JNK activation through MAP3K4.
      The DIX domain mediates interaction with AXIN1 and inhibition of AXIN1-mediated JNK activation through MAP3K1. Mediates interaction with DVL2; this interaction is required for activation of Wnt signaling.
    • Post-translational
      modifications
      Phosphorylated on tyrosine and serine residues.
      Polyubiquitinated, leading to its proteasomal degradation. WNT3A signaling increases DIXDC1 protein levels by inhibiting its ubiquitination and subsequent degradation.
    • Cellular localization
      Cytoplasm; Cell junction > focal adhesion. Associated with actin stress fiber at the filament ends and Cytoplasm > cytosol. Colocalizes with gamma-tubulin at the centrosome, both during interphase and mitosis.
    • Information by UniProt
    • Database links
    • Alternative names
      • CCD1 antibody
      • Ccd1Aalpha1L antibody
      • Ccd1Abeta1L antibody
      • Ccd1BalphaL antibody
      • Ccd1BbetaL antibody
      • Ccd1CL antibody
      • Coiled coil DIX1 antibody
      • Coiled coil protein DIX1 antibody
      • Coiled-coil protein DIX1 antibody
      • Coiled-coil-DIX1 antibody
      • DIX domain containing 1 antibody
      • DIX domain containing protein 1 antibody
      • DIX domain-containing protein 1 antibody
      • DIXC1_HUMAN antibody
      • DIXDC1 antibody
      • Dixin antibody
      • KIAA1735 antibody
      see all

    Images

    • Detection of DIXDC1 in Immunoprecipitates of 293T whole cell lysate (1 mg for IP, 20% of IP loaded) using ab177517 at 6 µg/mg lysate for IP. An alternative anti-DIXDC1 antibody was used at 1 µg/ml for subsequent western blot detection.

      Detection: Chemiluminescence with exposure time of 3 minutes.

    References

    ab177517 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab177517.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up