Overview

  • Product name

  • Description

    Rabbit polyclonal to DKK1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human DKK1 aa 33-263. Full length mature chain without the signal peptide.
    Sequence:

    LNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQP YPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNY CKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTK GQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLE IFQRCYCGEGLSCRIQKDHHQASNSSRLHTC


    Database link: O94907

  • Positive control

    • IHC-P: Human placenta and glioma tissues. ICC/IF: U-251 MG cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab235990 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.
  • Tissue specificity

    Placenta.
  • Sequence similarities

    Belongs to the dickkopf family.
  • Domain

    The C-terminal cysteine-rich domain mediates interaction with LRP5 and LRP6.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Dickkopf 1 antibody
    • Dickkopf 1 homolog antibody
    • Dickkopf 1 like antibody
    • Dickkopf homolog 1 antibody
    • Dickkopf like protein 1 antibody
    • Dickkopf related protein 1 antibody
    • Dickkopf WNT signaling pathway inhibitor 1 antibody
    • Dickkopf-1 antibody
    • Dickkopf-related protein 1 antibody
    • DKK 1 antibody
    • Dkk-1 antibody
    • Dkk1 antibody
    • DKK1_HUMAN antibody
    • hDkk 1 antibody
    • hDkk-1 antibody
    • SK antibody
    see all

Images

  • U-251 MG (human brain glioma cell line) cells stained for DKK1 (green) using ab235990 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human placenta tissue stained for DKK1 using ab235990 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human glioma tissue stained for DKK1 using ab235990 at 1/100 dilution in immunohistochemical analysis.

References

ab235990 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235990.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up